KEGG   Proteus mirabilis HI4320: PMI1214Help
Entry
PMI1214           CDS       T00753                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pmr  Proteus mirabilis HI4320
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PMI1214 (ahpF)
Enzymes [BR:pmr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PMI1214 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 HI0933_like FAD_oxidored Thi4 FAD_binding_3 DAO AlaDh_PNT_C NAD_binding_8 K_oxygenase FMO-like Glutaredoxin Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CAR42590
UniProt: B4ETU4
LinkDB All DBs
Position
1282192..1283757
Genome map
AA seq 521 aa AA seqDB search
MLDNNLKAQLKAYLERLTQPVELVATLDDSKHSADIQALLKEIEPLSDKVTYREDNSANV
RKPSFLITNPGKTTGVRFAGSPLGHEFTSLVLALLQTGGHPSKEAPELLEQIRQLDGEFH
FETYYSLSCHNCPDVVQALNLMAILNPNITHTAIDGGMFQNEIQERNIMGVPAVFLNGNE
FGQGRMTLAEIVSKVDSNAEKRTAELLNKKDAFDVLIVGSGPAGASAAVYAARKGLNTGL
IGERFGGQVLDTVDIENYISVPKTEGAKLAGALKAHVDDYQVDVIDSQTVSRLIPGAAEG
DLHQIETASGAILKTRSLIIATGARWRNMNVPGENEYRTRGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVEHVTVLEFASEMRADAVLQNKLRSLSNVDVILNAQTTEVYGD
GTKLTGLKYKDRTNDSMHDIALAGIFVQIGLLPNTQWLDGTVERNKIGEIVVDSRGETNI
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTTAK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagataataatttaaaagctcaactgaaagcttacctagaacgattaacccagcca
gttgagttagttgcaacattagacgacagcaaacattctgctgatatccaagccttatta
aaagaaattgaaccgttatctgataaagtcacataccgtgaagataacagtgctaatgtg
cgcaaaccatcttttcttattaccaacccagggaaaacaactggcgttcgttttgcaggc
tcgccattaggtcatgagtttacttctttagtattagcattattacaaaccggtggtcat
ccatctaaagaagccccagaattacttgaacaaattcgtcagttagacggtgagtttcat
ttcgaaacctattattcgctctcttgtcataactgccctgatgttgttcaggcattaaac
ttaatggcgattttaaatccgaacatcacccatacggcgatcgacggaggcatgttccaa
aatgaaattcaggaacgtaatatcatgggcgttcctgcggtattcttaaatggcaacgag
tttggccaaggtcgtatgactttagctgaaattgttagcaaagtagatagcaatgcagaa
aaacgcactgcagagttattaaataaaaaagatgcctttgatgttttgattgtcggaagc
ggccctgcgggggcatcagcggcagtatatgctgcacgtaaaggcttaaatacaggtctt
atcggtgaacgttttggtggacaagttctcgatactgttgatattgaaaactatatctct
gtacctaaaacagaaggtgcaaaattagctggggctttaaaagctcatgttgatgattat
caagttgatgtcattgacagccaaactgtcagccgtttaattccgggagcagcggaaggt
gatctacaccaaattgaaaccgcatctggtgcgattttaaaaacccgtagcttaattatt
gccacgggtgctcgctggagaaatatgaacgtaccgggtgaaaacgagtaccgtactcgc
ggtgtaacatactgcccacattgtgatggtcctctatttaaaggtaaaagagtggctgtt
attggtggtggtaactcgggtgttgaagctgccattgacttagcgggtttagtggagcac
gtgaccgtactagaatttgcctcagaaatgagagccgatgctgttttacaaaataaactg
cgtagcttaagtaatgtcgatgttatcttaaatgcccaaacaacagaagtatatggagat
ggcactaagttaacaggactgaaatataaagatcgcactaacgattcaatgcatgatatt
gccttagcgggtattttcgtccaaattggtttactgccaaacacacaatggttagacgga
actgttgagcgtaataaaattggtgagatcgtggttgattcacgtggtgaaaccaatatt
aaaggggtatttgctgcgggtgactgtacaactgttccttataaacaaattattatcgcc
gcgggtgaaggtgcaaaagcctcattaagcgcctttgattacttaattcgcacaacggca
aaataa

DBGET integrated database retrieval system