KEGG   Proteus mirabilis HI4320: PMI1333Help
Entry
PMI1333           CDS       T00753                                 

Gene name
sodC
Definition
(GenBank) copper-zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pmr  Proteus mirabilis HI4320
Brite
Enzymes [BR:pmr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PMI1333 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CAR42823
UniProt: B4EW24
LinkDB All DBs
Position
complement(1410453..1410977)
Genome map
AA seq 174 aa AA seqDB search
MKLIPLLLSGLLFTSVASAASLDVTLKEALPTGAGDDIGVVTITETDYGLLFTPKLTGLT
PGVHGFHIHANGSCEPDMKDGKPVPALKAGGHLDPENKGVHLGPYNKEGHLGDLPGLVAN
SKGDADYAVLAPRLTKLDQIKDKALMVHVGGDNYSDNPEALGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatacctttgttactctctggactactctttacatcggttgccagtgcggcg
agcttagatgttacgttaaaagaagccttacctacaggggcgggtgatgatattggtgtt
gtcactattaccgaaaccgattatgggctgttatttacgccaaaacttactgggttaaca
ccgggtgttcatggttttcatatccatgctaatggctcttgtgagccagatatgaaagat
ggaaaacctgttccagcattaaaagcgggtggtcatcttgatcctgaaaataaaggtgtt
cacttagggccttataacaaagaagggcatttaggtgatctacctggtttggttgccaat
agtaaaggtgacgctgattatgccgttcttgctcctagactgactaagcttgatcaaatt
aaagataaagccttaatggttcacgttgggggagataactactcagataacccagaagcg
cttggcggtggtggtgctagaatggcatgtggtgtgattaaataa

DBGET integrated database retrieval system