KEGG   Proteus mirabilis HI4320: PMI1407Help
Entry
PMI1407           CDS       T00753                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00250  Alanine, aspartate and glutamate metabolism
pmr00410  beta-Alanine metabolism
pmr00430  Taurine and hypotaurine metabolism
pmr00650  Butanoate metabolism
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01120  Microbial metabolism in diverse environments
pmr02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PMI1407 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PMI1407 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PMI1407 (gadB)
   00430 Taurine and hypotaurine metabolism
    PMI1407 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PMI1407 (gadB)
Enzymes [BR:pmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PMI1407 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CAR42970
UniProt: B4EWN7
LinkDB All DBs
Position
complement(1485617..1487008)
Genome map
AA seq 463 aa AA seqDB search
MNKKTPSYSSLDDVYASVDLSQSLPKTHFPQQESHPRHVFDAVRDELMLDGNSRQNLATF
CQTWVDDEIRDLMNLSIDKNMIDKDEYPQTAEIENRCVHMLADLWHSPDPLNTLGCSTIG
SSEAAMLGGLALKWQWRKKRLAAGKATDKPNLICGPVQVCWHKFARYFDVELREIPLEGD
RLMMSPEEVIKRVDENTIGVVPTLGVTFTCTYEPVKAVHDALDQLQKETGLDIPIHVDGA
SGGFLAPFCAPDLEWDFRLPRVKSINSSGHKFGLAPLGSGWVVWREAKDLPEELIFNVNY
LGGNMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKIHNACYHTAQYLAREIEKLGPFEM
IFSGDSQKGIPALAWKLKKEAKVSYSLYDIADKLRSRGWQVPAYSMPADRQDLVIQRILV
RHGVSLDLATLLIEDMKRTLDYFEKHPVSTPLSEEDGGGFNHS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaacgccaagttatagctcactcgatgatgtttatgcatcggttgattta
tcacaatccttaccgaaaacacattttccgcaacaagagagccatcctcgtcatgttttt
gatgctgtaagggatgagctgatgctagatggcaattcaagacaaaatctggccacattt
tgtcaaacctgggtagatgatgagatccgtgatttgatgaatttatctatcgataagaac
atgatagataaagatgaatatccacaaacggccgaaattgaaaaccgttgtgttcatatg
cttgctgatttatggcactcacccgatccactcaataccctaggttgttcaaccattggc
tcctctgaagcggcaatgctggggggacttgcattaaaatggcaatggcgtaaaaaacgc
cttgctgctggaaaagcgacagataaacctaatcttatttgtgggccagttcaagtctgt
tggcataaatttgcccgttattttgacgttgaactcagagagatcccgcttgaaggtgat
cgcttgatgatgagtcctgaagaggtcattaaacgtgttgatgaaaatactatcggtgta
gtgccaacattaggggtgaccttcacctgtacttatgagccagtaaaagcggtacatgat
gcactcgaccaactacaaaaagagaccggacttgatattcctattcatgttgatggtgcg
agtggtggctttttagcgcctttctgtgcacctgatttagaatgggatttccgtttaccg
cgtgttaaatccattaactcatcaggccataagtttggtttagcgccattgggctctggt
tgggtagtatggcgtgaagccaaagacttaccggaagagcttatttttaatgtgaactac
cttggcggtaatatgccaacctttgcgcttaatttctcacgtcccggtgggcaaattatt
gctcaatactataatttcttgcgtcttggcagagaagggtatgcgaagatccacaatgcc
tgttatcacaccgcgcaataccttgctcgagaaattgaaaagctagggccttttgaaatg
atcttcagtggtgatagtcaaaaaggaatacctgcattagcgtggaaactgaaaaaagag
gctaaggtaagctactccttatatgacatcgctgataaattgcgtagccgtggctggcaa
gtacccgcttattctatgcctgctgatcgccaagatttagttattcaacgtattcttgtt
cgtcatggtgtgagtttagatttggcgacattactgatagaagatatgaaacgtactctc
gattatttcgaaaaacatcctgtcagcacacctttatctgaagaggacggcggtggcttt
aaccacagctaa

DBGET integrated database retrieval system