KEGG   Proteus mirabilis HI4320: PMI2930Help
Entry
PMI2930           CDS       T00753                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00564  Glycerophospholipid metabolism
pmr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PMI2930 (glpD)
Enzymes [BR:pmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PMI2930 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N GIDA Mqo FAD_oxidored Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-ProteinID: CAR45770
UniProt: B4EZN2
LinkDB All DBs
Position
3211685..3213178
Genome map
AA seq 497 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLASATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLRLAPHIAFPMRFRLPHQPHLRPAWMIRIGLFLYDHLGKRVSLPGS
KSIKFGANSVLKPELTRGFEYSDCWVDDARLVVLNAQEIVRRGGEVRTRTKVTRAWREND
LWMVEAQDLRTGETSRYQAKALVNAAGPWVKTLFDEGLKLKSPYGIRLIKGSHIVIPRAH
DEPQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKDVAIDNNEVEYLLKVYNDHF
KKQLTKDDIVWNYSGVRPLCDDESDSPQAITRDYTLDVHDDNGKTPLLSVFGGKLTTYRK
LGEHAVDKLNAYFPNMGQAWTKEGQLPGGNLEGYDRDGYSRLIRQRHPWLPEALALRFAR
TYGSNTEVLLEGITDLAGMGENFGHNLYEAELRYLVKHEWVIELDDAIWRRTKLGMWLND
EQKQRITQWLEANTHTA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaagacttgattgtcatcggcggcggaataaacggcgctggaattgcggcg
gatgcagcaggccgaggcctttcagtattaatgctggaagctcaagacttagccagtgca
acatcttccgctagctcaaaattaattcatggtggcttacgctatttagagcattacgaa
ttccgtttagtcagtgaagcattggctgaacgtgaagttttattgcgtttggcgcctcat
atcgcatttccgatgcgtttccgtttaccgcatcaaccccatctacgcccagcatggatg
atccgcattggtttattcctctatgatcacctaggcaaacgtgtcagtttaccgggcagt
aaaagtattaaattcggggctaactctgtcttaaaacctgaattaactcgtggttttgaa
tattccgactgttgggtagatgatgctcgtttagtagtattaaatgcgcaagagatcgtt
cgtcgtggcggtgaagttcgtactcgtaccaaagtgacgcgcgcttggcgtgaaaacgat
ttatggatggtggaagcacaagatttacgcaccggagaaacttctcgctaccaagcaaaa
gcattagtgaatgcagccggtccttgggttaaaacattattcgatgaagggttaaaatta
aaatcaccttatggtattcgcttaatcaaaggtagccatattgtgatcccacgtgctcac
gatgaaccccaagcctatatcttacaaaatgaagataatcgcattgtattcgtgatccct
tggatggatgagttctctattattggtaccactgatgttgaatacaaaggtgatccaaaa
gatgtggctattgataacaatgaagttgagtacttattaaaagtctataacgaccacttt
aagaaacaactgaccaaagacgatatcgtctggaattattcaggggtgcgtccattgtgt
gatgacgaatccgattcgccacaagctatcactcgtgactataccttagatgtacatgat
gataatggtaaaacaccactactctctgtgtttggtggtaaattaacgacttatcgtaaa
ctcggtgaacacgcggttgataagctaaatgcttatttccctaatatgggtcaagcgtgg
acaaaagagggtcaattaccgggggggaacttagaaggttacgatcgtgatggctattca
cgtcttattcgccaacgtcatccttggttaccagaagcattagcactacgttttgctcgc
acttatggtagcaatactgaagtgttgctagaaggaattactgatttagccggaatgggc
gaaaatttcggtcataatctttacgaagctgaattacgttatttagttaaacatgagtgg
gtgattgagcttgatgatgctatttggcgtcgtaccaaacttggtatgtggcttaatgat
gaacaaaaacaacgtattacgcaatggttagaggcaaatacgcacacagcataa

DBGET integrated database retrieval system