KEGG   Proteus mirabilis HI4320: PMI3026Help
Entry
PMI3026           CDS       T00753                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pmr  Proteus mirabilis HI4320
Pathway
pmr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmr01100  Metabolic pathways
pmr01110  Biosynthesis of secondary metabolites
pmr01130  Biosynthesis of antibiotics
pmr01230  Biosynthesis of amino acids
Module
pmr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pmr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PMI3026 (aroK)
Enzymes [BR:pmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PMI3026 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 dNK Cytidylate_kin AAA_16 AAA AAA_22 APS_kinase ABC_tran TsaE AAA_7 Ploopntkinase3 AAA_25 RNA_helicase AAA_17 AAA_5 AAA_PrkA RsgA_GTPase AAA_29 DUF1318 Mg_chelatase DUF4470 AAA_28 NTPase_1 His_biosynth PduV-EutP AAA_24 IstB_IS21 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: CAR45958
UniProt: B4F0B0
LinkDB All DBs
Position
3323307..3323828
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLSMEFYDSDQEIERRTGADVGWVFDVEGEEGFR
QREEKIINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETNIEKQLARTQRDKKR
PLLQGVEPVRDVLETLAEERNPLYEEIADITIHTDDQSAKIVANQIIELLEKN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgtaatatctttctggttgggcctatgggtgccggcaaaagcactatt
ggtcgtcagttagctcaacaacttagtatggaattttatgattccgatcaggaaattgag
cgacgtacaggtgcagatgtaggttgggtatttgatgtagaaggcgaagaaggcttccgt
caacgtgaagaaaaaataatcaacgaacttactgaaaagcaaggcattgtactggcaaca
ggtggtggttcggtgaaatcaagagaaacccgtaaccgactatcagcacgcggtgttgtt
gtttatttagaaaccaacattgaaaaacaacttgctcgtactcagcgagataaaaaacgt
cctttattgcaaggtgttgaacccgtacgtgatgtactggaaaccctcgcagaagaacgt
aatcctctttacgaagagattgctgatatcaccattcatactgatgatcagagtgcaaaa
atcgttgcaaatcaaattattgaattattagagaaaaactaa

DBGET integrated database retrieval system