KEGG   Paenibacillus mucilaginosus KNP414: KNP414_00199Help
Entry
KNP414_00199      CDS       T01550                                 

Gene name
hisI
Definition
(GenBank) HisI
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00340  Histidine metabolism
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01230  Biosynthesis of amino acids
Module
pms_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pms00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    KNP414_00199 (hisI)
Enzymes [BR:pms01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     KNP414_00199 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     KNP414_00199 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG ANAPC4_WD40
Motif
Other DBs
NCBI-ProteinID: AEI38842
UniProt: F8FKY2
LinkDB All DBs
Position
200091..200798
Genome map
AA seq 235 aa AA seqDB search
MSGAQGAVESIEALQAAVKWDAHGLVPAIVQDALSKEVLMMAYMNEESLKLTLESGETWF
WSRSRQELWHKGATSGHTQKVTSLRYDCDGDTLLVLVEQKGPACHTGSYSCFFNDVKLGA
LAGAEAAAANESDRFAMLAKVEAVIAQRDAERPEGAYTTYLFEKGIDKILKKIGEEAGEV
IIAAKNQDNDELRYEATDLLFHLMVLLRERKVPLDDLMFELGRRYNKPKSEYSLE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagcgcagggagcagtagagagcatagaggcgctgcaggcggctgtcaagtgg
gatgcccacggcctcgtgcccgccatcgtccaggatgcactgagcaaagaagtgctgatg
atggcctatatgaatgaggagtcgctgaagctgactctggaatcgggcgagacctggttc
tggagccgttcgcgtcaggaactgtggcataaaggcgctacgtccggacatacccagaag
gtcacatcgctgcggtacgactgtgacggagacacgctgctcgtgcttgtcgagcagaag
gggcctgcctgccataccggcagctacagctgtttcttcaatgatgtgaagctgggtgcg
cttgcgggagcggaggcagccgctgcaaatgaatcggaccgcttcgccatgctggcgaaa
gtggaggccgtgattgcccagcgtgacgcagagcggccggaaggcgcgtacacgacgtac
ctcttcgagaaggggatcgacaagatcctgaagaagatcggtgaggaagcgggcgaagtg
atcatcgcagccaaaaatcaggataacgacgagcttcgctacgaagcgacggacctgctc
ttccacctgatggtgctgctgcgcgagcgcaaggtgccgctcgacgacctgatgttcgag
ctggggcgccggtacaacaaaccgaaatccgaatattcgctggaatag

DBGET integrated database retrieval system