KEGG   Paenibacillus mucilaginosus KNP414: KNP414_01281Help
Entry
KNP414_01281      CDS       T01550                                 

Gene name
icd
Definition
(GenBank) Icd
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00020  Citrate cycle (TCA cycle)
pms00480  Glutathione metabolism
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
pms01210  2-Oxocarboxylic acid metabolism
pms01230  Biosynthesis of amino acids
Module
pms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pms_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KNP414_01281 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KNP414_01281 (icd)
Enzymes [BR:pms01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     KNP414_01281 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEI39846
UniProt: F8FHE4
LinkDB All DBs
Position
1288788..1290083
Genome map
AA seq 431 aa AA seqDB search
MAQFEQYALPTEGERITITNGVLNVPNNPIIPFIEGDGTGPDIWAASKRVLDAAVEKAYN
GEKKIAWYEVFAGEKAFNKYNNWLPADTLTAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCSRPVRYFKGVPSPVKRPELVDMVIFRENTEDIYAGIEWAAGSEEVKKVLAFLQ
NEMGVKKIRFPETSGIGVKPVSSEGSKRLVRAAIEYAIKHNRKTVTLVHKGNIMKFTEGA
FKNWGYELAEEEFGDKTFTWAQYDRIKEESGADAANAAQKAAEAEGKIIVKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
AGLDVVNPGSVILSGVMMLEHLGWLEAAELIYKGMETAINNKTVTYDFARLMEGATEVKC
SAFADQIIANF
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattcgaacaatatgctctgccgactgagggcgagcgcatcacaattacgaac
ggcgtactgaacgtaccgaacaacccgatcattcctttcatcgaaggcgacggcacaggc
ccggacatctgggcggcttccaagcgtgtgctggatgcagcggtagagaaagcatataac
ggagagaagaaaatcgcttggtacgaagtgttcgccggcgagaaagccttcaacaagtac
aacaactggctgcctgctgatacgctgacagcgatccgtgaatacatcgtagcgatcaaa
gggcctctgacgacgccaatcggcggcgggatccgctccctgaacgttgcgctccgtcaa
gagctggacctgtatgtctgctcccgtccggtccgctacttcaaaggcgtaccttcccct
gtaaagcgtcctgagctcgttgacatggtcatcttccgtgagaacaccgaagacatctat
gccggcatcgagtgggctgcaggctccgaagaagtcaagaaagtgctcgcgttcctccag
aacgaaatgggcgttaagaaaatccgcttcccagagacttccggtatcggcgtgaagccg
gtgtcctccgaaggttcgaagcgtctggttcgtgcggcgatcgaatatgcgatcaagcac
aaccgcaaaacggttaccctcgtacacaaaggcaacatcatgaagttcaccgagggcgcg
ttcaagaactggggctacgagctggctgaagaggagttcggcgacaagaccttcacttgg
gctcaatacgaccgcatcaaagaagagtcgggtgcagatgcagcgaacgcagctcaaaaa
gcagcggaagctgaaggcaaaatcatcgtaaaagatgcgattgccgacatcgcgctgcag
caggttctgactcgtccgaccgacttcgacgtcatcgcgacgctgaacctgaacggcgac
tacctgtccgacgctctggctgctcaagtaggcggcatcggtatcgctcctggcgcgaac
atcaactatgtaacgggccacgcgatcttcgaagctacacacggtacggctcctaagtac
gcaggtctggacgttgtgaacccaggttccgtcatcctctccggcgttatgatgctcgag
cacctgggctggctggaagcggctgagctgatctacaaaggcatggaaacggcgatcaac
aacaagaccgttacttatgactttgcccgtctgatggaaggcgcaaccgaagtgaagtgc
tccgcgttcgctgatcagattattgctaacttttaa

DBGET integrated database retrieval system