KEGG   Paenibacillus mucilaginosus KNP414: KNP414_02090Help
Entry
KNP414_02090      CDS       T01550                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms03030  DNA replication
pms03410  Base excision repair
pms03420  Nucleotide excision repair
pms03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pms00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    KNP414_02090
   03410 Base excision repair
    KNP414_02090
   03420 Nucleotide excision repair
    KNP414_02090
   03430 Mismatch repair
    KNP414_02090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pms03032]
    KNP414_02090
   03400 DNA repair and recombination proteins [BR:pms03400]
    KNP414_02090
Enzymes [BR:pms01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     KNP414_02090
    6.5.1.6  DNA ligase (ATP or NAD+)
     KNP414_02090
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     KNP414_02090
DNA replication proteins [BR:pms03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    KNP414_02090
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     KNP414_02090
DNA repair and recombination proteins [BR:pms03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     KNP414_02090
   NER (nucleotide excision repair)
    Other NER factors
     KNP414_02090
   MMR (mismatch exicision repair)
    Other MMR factors
     KNP414_02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AEI40651
UniProt: F8FRU4
LinkDB All DBs
Position
2199835..2200689
Genome map
AA seq 284 aa AA seqDB search
MFISPMLLETAKHPFSNEHYLFEPKIDGHRLVLSRQGGQTRLYTRHHNDCTFQYPELNPV
ALDDVILDGEVAATDASGAIDFEAVMERFALRRADKVRRAAAERPVNYIVFDVLRYNGVD
LRGLPLYRRKEILAGIDFGNPHMAKVPVVPKEGERLFEQIAARQLEGIVAKRMDSVYVGH
RSEAWLKIINWQYAEVYLTGYKKEGFGWLAASAGPGGILKPAGLIELGITPKHRTAFNGV
RDQLQTGEDGEFVYLEPKLKAKVKMRNWTRAGLLRSPVFMEFCR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgtttatttctcccatgctgctcgagacggcgaagcatccgttctcgaacgagcattat
ctgttcgaaccgaaaatcgacggtcaccgtctggtgttatcccgccaaggcggtcagacc
cgtctttatacgcgtcatcacaatgactgcacgttccagtatccggagctgaacccggtc
gccttggacgatgtcatcctcgacggggaggtcgcggcgacagacgcttccggcgccatc
gacttcgaagccgtaatggaacgcttcgccctgcgcagggcggacaaagtgcgccgggcc
gccgccgaacggccggtcaactacatagtgttcgacgtgctgcgctataacggggtggac
ctgaggggcctgccgctgtacaggcgcaaggagattctcgccggcatcgacttcggcaat
ccgcatatggcgaaggtgccggttgttccgaaggagggcgagcggctcttcgaacagatc
gcggcacggcagctggaaggcatcgtcgccaaacggatggattccgtctatgtcggccac
cggtcggaggcctggctcaagatcatcaactggcagtacgcggaggtgtacctgaccgga
tacaagaaggaaggattcgggtggctggccgcatcagcggggccgggagggatcctgaag
cccgccggcttgatcgagcttggcattacgccgaagcacagaacagcgttcaacggtgta
cgggaccagcttcagaccggggaggacggggagttcgtctatctggagccgaagctgaag
gcgaaggtgaagatgcgcaattggacccgggctggacttctccgttccccggtgttcatg
gaattctgcaggtaa

DBGET integrated database retrieval system