KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03758Help
Entry
KNP414_03758      CDS       T01550                                 

Gene name
sdhA
Definition
(GenBank) SdhA
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00020  Citrate cycle (TCA cycle)
pms00190  Oxidative phosphorylation
pms00650  Butanoate metabolism
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
Module
pms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KNP414_03758 (sdhA)
   00650 Butanoate metabolism
    KNP414_03758 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KNP414_03758 (sdhA)
Enzymes [BR:pms01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KNP414_03758 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     KNP414_03758 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: AEI42297
UniProt: F8FHI9
LinkDB All DBs
Position
3881525..3883240
Genome map
AA seq 571 aa AA seqDB search
MMATIKAAEAGVHVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGDSPWEHFDDTVYGGDF
LANQPPVKAMCEAAPGIIHLMDRMGVMFNRTPEGLLDFRRFGGTKHHRTAFAGATTGQQL
LYALDEQVRRWETAGLVKKYEHWEFLGAVLDDDGVCRGIAGQDLRSMEVNTFKADAVILA
TGGPGIIFGKTTNSVINTGTAASAVYQQGVHYANGEFIQIHPTAIPGDDKLRLMSESARG
EGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFAVCVDMKLGVNGENMVYLDLSH
KDPKELDVKLGGIIEIYEKFMGDDPRKIPMKIFPAVHYSMGGMWVDYNQMTNIPGLFACG
ECEYQYHGANRLGANSLLSAIFGGMVTGPKAIEYIRGLDKSADDISSSVFDRYGKLHTDK
YEGILKMDGKENAYVLGKELGEWMTDNMTVVRYNKKLEQTIDKINELKQRYKNININDSA
RYNNPGVAYTRQLWNMLELAHAMTLGALLRNESRGAHYKPEFPERNDEQFLKTTKAAWTA
EGPQISYEEVDVSLIAPRKRDYTTDKKKGGH
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
ttgatggcgaccatcaaagcagcagaggccggcgttcacgtcgacctgttctccttggta
ccggttaaacgttctcactccgtctgtgctcagggcggcatcaacggtgccgtcaacacc
aaaggggaaggcgactcgccttgggagcacttcgacgatactgtatacgggggcgacttc
cttgcgaaccagccgccggttaaagccatgtgcgaagccgcaccgggcatcatccacctt
atggaccggatgggcgttatgttcaaccgtacgccggaaggtctcctggatttccgtcgt
ttcgggggcacgaagcaccaccgtaccgcgttcgcaggcgcaaccaccggccagcagctg
ctgtacgcgctcgatgagcaggtgcgccgctgggagaccgcaggtctcgtcaagaagtac
gagcactgggagttcctcggcgcggttctcgatgacgacggcgtatgccgcgggatcgca
gggcaggatctgcgaagcatggaagtcaataccttcaaggccgatgcggtcatcctggct
accgggggccccggcatcattttcggcaagacgacgaactccgtcatcaacaccggtacg
gcagcgagtgccgtgtaccagcagggtgtgcactatgccaacggcgagttcatccagatt
caccctacggcgatcccgggcgacgacaagctgcgcctgatgtccgaatccgcacggggc
gaaggcggccgcgtatggacgtacaaggacggcaagccgtggtacttcctggaagagaaa
tatccggcgtacggcaacctcgtaccgcgtgatattgcaacacgtgagatttttgcggtc
tgcgtagacatgaagctcggcgtcaatggcgagaacatggtttacctcgacctgtcgcat
aaggatccgaaggagctcgacgtgaagctcggcgggatcattgagatctacgagaagttc
atgggcgacgacccgcgcaagattccgatgaagattttccctgcggtacactattcgatg
ggcggcatgtgggtcgactacaaccagatgacgaacatcccgggcctcttcgcctgcggc
gagtgcgaataccagtaccacggtgcgaaccgtctcggtgcgaactccctgctgtccgcg
atcttcggcggaatggttaccggtccgaaagcgatcgagtacatccgtggactcgacaag
tcggccgatgacatctcctcctccgtattcgaccgttacggcaagctgcacacggacaag
tacgaaggcatcctgaagatggacggcaaagagaatgcatacgtgctcggtaaagagctc
ggcgaatggatgaccgataacatgacggttgttcgttataacaagaagctcgagcagacg
atcgacaagatcaacgagctcaagcagcgctacaagaacatcaatatcaacgactccgcg
cgctacaacaaccctggtgtggcgtacacccgccagctgtggaacatgctcgagctcgcg
catgcgatgacgctcggcgccctgctgcggaacgaaagccgcggagcccactacaagccg
gagttccctgagcgcaacgacgagcagttcctgaagacgaccaaggcggcatggacggcc
gaaggcccgcaaatttcgtacgaagaagtcgacgtgtctctcattgcaccgcgtaagcgt
gactatacgaccgataagaagaagggaggtcattaa

DBGET integrated database retrieval system