KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03759Help
Entry
KNP414_03759      CDS       T01550                                 

Gene name
sdhB
Definition
(GenBank) SdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00020  Citrate cycle (TCA cycle)
pms00190  Oxidative phosphorylation
pms00650  Butanoate metabolism
pms01100  Metabolic pathways
pms01110  Biosynthesis of secondary metabolites
pms01120  Microbial metabolism in diverse environments
pms01130  Biosynthesis of antibiotics
pms01200  Carbon metabolism
Module
pms_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pms_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KNP414_03759 (sdhB)
   00650 Butanoate metabolism
    KNP414_03759 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KNP414_03759 (sdhB)
Enzymes [BR:pms01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KNP414_03759 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     KNP414_03759 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_2 Fer4 Fer2_4 Fer4_13 Fer4_4 Fer4_21 Fer4_15 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AEI42298
UniProt: F8FHJ0
LinkDB All DBs
Position
3883243..3884010
Genome map
AA seq 255 aa AA seqDB search
MAEATATASRKVKFIVTRQDSADGKSYTEEFEVPYRPNMNVISALMEIQRNPVNASGKTT
TPVCWESNCLEEVCGACSMVINGKPRQACSALVDKLEQPIRIAPMSTFPVVRDLVINRER
MFSALKKVKAWIPIDGTYDLGPGPRMAEAKRQWAYELSKCMTCGVCLESCPNVNDKTDFI
GPAAVSQVRLFNAHPTGEMNAHERLEALMEDGGIEGCGNSQNCVRSCPKGIPLTTSIAAM
NLDTTKHLFKKWLGM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcaaccgcaactgcaagcaggaaggttaaattcatcgtcacccgccaggat
tccgcggacggcaagtcctacaccgaggaattcgaagtgccttaccgccccaacatgaac
gtcatctcggcgctgatggaaattcagcgtaatccggtgaacgcttcgggcaaaacaacg
acgccggtatgctgggaatcgaactgccttgaggaagtatgcggcgcctgctccatggtt
attaacggcaagccgcgccaggcgtgctccgcgctcgtcgacaagctcgagcagccgatc
cgcattgctccgatgtcgacgttccctgtcgtgcgtgaccttgtcatcaaccgggagcgt
atgttctccgcgctgaagaaggtcaaagcatggatcccgatcgacggtacgtacgatctc
ggtccggggccgcgtatggcggaagcgaagcgccaatgggcttacgagctgtcgaagtgc
atgacctgcggtgtctgcctggagtcctgtccgaatgtcaacgacaagacggacttcatt
ggacctgcggccgtatcgcaggtgcgtctgttcaacgctcacccgacaggggagatgaac
gcgcacgagcgtctcgaggcgctgatggaagacggcgggatcgagggctgcggcaactcg
cagaactgcgtgcgttcctgcccgaagggcattccgctgacgacctccatcgcagcgatg
aacctcgatacgacgaagcatctgttcaagaaatggctcggcatgtaa

DBGET integrated database retrieval system