KEGG   Paenibacillus mucilaginosus KNP414: KNP414_04553Help
Entry
KNP414_04553      CDS       T01550                                 

Definition
(GenBank) bifunctional deaminase-reductase domain protein
Organism
pms  Paenibacillus mucilaginosus KNP414
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RibD_C Fibrillarin
Motif
Other DBs
NCBI-ProteinID: AEI43083
UniProt: F8FBN2
LinkDB All DBs
Position
complement(4897888..4898466)
Genome map
AA seq 192 aa AA seqDB search
MRRIIMLNRISIDGYFASLNENTFGMDWFVQDPEVDIAVRSGGGTLDTLILGGHTYRGFE
RNWVPILHDPRAPKEWKAVAEELTAMTKIVFSSEQKEITWANTRRFNGSVVEVSQRLKEE
EGSDILIMGSGTIVRQLAAEGLIDEYVFILTPVVAGQGKPLFEHVYEFGLTLTETKAFAS
GNVLLRYQLKQG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaatcatcatgctgaaccggatttcgatcgacggttattttgcgagtttgaat
gagaacactttcggcatggattggttcgtgcaagatccggaagtggatatcgccgtacgt
tccggcggtgggacgctggacacactgatccttggcgggcatacataccgggggtttgag
cgaaactgggtgcccatccttcatgatccccgtgctccgaaagaatggaaagctgtggca
gaagaacttacggccatgacgaagatcgtgttctcaagcgaacaaaaagagattacctgg
gcaaataccaggcgattcaacggctccgtagtcgaagtatcgcagagattgaaggaagag
gaaggcagcgatattctgattatgggcagcggcaccatcgtccggcagctggctgcggaa
ggcttgattgacgagtacgtatttatcctcacaccggtggtggcggggcaggggaaaccg
cttttcgaacatgtctatgagttcggactcacactgacggagacaaaggcgtttgcctcc
ggcaatgttctgctgcgttatcagctgaagcaggggtag

DBGET integrated database retrieval system