KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06333Help
Entry
KNP414_06333      CDS       T01550                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00061  Fatty acid biosynthesis
pms00071  Fatty acid degradation
pms01100  Metabolic pathways
pms01212  Fatty acid metabolism
pms02024  Quorum sensing
Module
pms_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pms00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    KNP414_06333
   00071 Fatty acid degradation
    KNP414_06333
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    KNP414_06333
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pms01004]
    KNP414_06333
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pms04147]
    KNP414_06333
Enzymes [BR:pms01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     KNP414_06333
Lipid biosynthesis proteins [BR:pms01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   KNP414_06333
Exosome [BR:pms04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   KNP414_06333
  Exosomal proteins of breast cancer cells
   KNP414_06333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEI44854
UniProt: F8FLT8
LinkDB All DBs
Position
complement(6986380..6988086)
Genome map
AA seq 568 aa AA seqDB search
MSAKPWLAHYPAEVPPSYDYPKQHAAQFLLDAARDYPRRAAVDFLGGRLSYAALLQAAYR
FANALRHLGVHQGDRVAIMLPNCPQAVIAFYGTLLLGGIVVMTNPMYTPRELLHQFGDAG
VRTVVTLDLLYKRVAQTAEAAGLRRIIVTSLKDYMPFPKSLLYPLFARRQGLDRSVDYGD
GVYAWPKLLKAASPEPYWHNVDPEEDLALIQYTGGTTGRPKGVMLTHANLVTATIQNRLW
AYRCKRGEEVYLAALPFFHVFGLTVLLNQSVALAGTLALLPRFDLDLLFETLKRTQPTVF
PGAPTMYISFLGDPRSLRFRGRAPSVCVSGAAPLPLEVQERFEALTGGRLIEGYGMTEAS
PVTHANPIWGKRKPGSIGIPFPDTEAKVIDPETGEELPAGEIGELIVRGPQVMKGYWNRP
EETAAVLKNGWLYTGDLGKMDEEGFFTILDRKKDLIIAGGFNIYPREVEEVLYEHPDVVE
AVVAGIRDAYRGETVKAYVVLKEGSEAGRDELDRWCRERLAAFKVPQQYEFRSTLPKSLV
GKILRRALLEEEAERKAAEKEEEERIPT
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctaagccttggctggcccattatcctgccgaggtgccgccgagttacgattac
ccgaagcagcatgcagcgcagttcctgctcgatgcggcccgggattacccgcgccgggcc
gccgtcgatttcctcggagggcgcttgtcgtatgcggcgctgcttcaggcggcttaccgg
ttcgcgaatgcgctgcggcatctcggcgttcaccagggggaccgggtggcgatcatgctg
ccgaactgtccgcaggcggtgatcgcattctacggcaccctgctgctcggcggcatcgtc
gtcatgacgaacccgatgtatacgccccgcgagctgctgcaccagttcggcgatgcgggg
gtgcggacggtggtgacgctcgacctgctgtataagcgggtcgcccagacggcggaagcc
gcgggtctgcggcggatcatcgtcacctcgctgaaggattatatgccgttccccaaaagc
ctgctctacccgctgttcgcgcgccggcagggtctggaccgctcggtcgactacggggac
ggcgtctatgcctggcccaagctgctcaaggcggcttcccccgagccctactggcacaat
gtcgatccggaggaggatctggccctgatccagtataccggcggcacgacgggccggccc
aaaggggtgatgctcacccatgcgaacctcgtcacggcgacgattcagaacaggctgtgg
gcttaccggtgcaagcgcggcgaagaggtgtatctggcggcgctgccgttctttcatgtg
ttcggcctgaccgtgctcctgaaccagtcggtcgcgctggcggggacgctggctctgctg
ccgcgcttcgatctcgacctgctgttcgagacgctgaagcggacgcagccgacggtgttc
ccgggagcgccgaccatgtacatctcgttcctcggcgatccccgttcgctgcgattccgc
ggccgggcgccctcggtctgcgtcagcggggcggcccctctgccgctcgaggtgcaggag
cgcttcgaggcactgaccggcggccggctcatcgaggggtacggcatgacggaggcttcg
ccggtgacccatgccaacccgatctggggcaagcgcaagccgggctcgatcgggattcct
tttcccgatacggaggcgaaggtgatcgatccggagacgggcgaggagctgccggcaggt
gagattggtgaacttatcgtgcgcggtccccaggtgatgaagggctattggaaccgcccg
gaagagacggcggcggtgctgaagaacggatggctgtacaccggcgatctcgggaagatg
gatgaggagggattttttacgattctggaccgcaaaaaagacctcatcatcgccggaggg
ttcaacatctatccgcgggaggtcgaagaagtgctgtatgagcatccggacgtggtggag
gcggtggtggccggcatccgcgacgcgtaccggggcgagacggtcaaggcctacgtggtg
ttgaaggaaggcagcgaggcggggcgcgacgagctcgaccgctggtgccgggagcgtctg
gccgccttcaaggtgccgcagcagtatgaattccggagcacgctgccgaagtcgctcgtc
ggcaagattctgcgtcgggcgctactggaggaagaagccgagaggaaggcggcggagaag
gaagaggaagagcgtatccccacttga

DBGET integrated database retrieval system