KEGG   Paenibacillus mucilaginosus KNP414: KNP414_06934Help
Entry
KNP414_06934      CDS       T01550                                 

Definition
(GenBank) AP endonuclease, family 2
Organism
pms  Paenibacillus mucilaginosus KNP414
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 SH3_16
Motif
Other DBs
NCBI-ProteinID: AEI45446
UniProt: F8FGR9
LinkDB All DBs
Position
complement(7618400..7619245)
Genome map
AA seq 281 aa AA seqDB search
MNMALSIWSCHTYLQNGQWTNADFIRFVAQETKAAGVELLTYFWKGEELEEVRKALAETR
IQVAAVGASNNFSHPDPQRRRVEVDEILAAVHLAETFGARIVRVFAGDRPPEGYAFDEVK
AWIVEGLREAAAAAAEKDIVLCLENHGVFAGQAGQVQAILDEVGSPYLRSTFDTGNFLLV
GEDPTAALEALGPQVAHVHFKDFVPVDEGYAGRAYTGLTGERFAGRIAGEGMIDLPGLLG
RLHQDGYRGWLTVEYEGDDEQKLGAAGSLANLARILEGLPA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggcactgagcatctggagctgtcacacttaccttcagaacgggcagtggacg
aacgcggactttatccgctttgtggcgcaggagacgaaggccgcgggcgtggagctgctg
acgtatttctggaagggggaggagctggaggaggtccggaaggccttggcggaaacccgg
atccaggtggctgcggtaggcgcctccaataatttctcgcacccggacccgcagcggcgc
cgggtggaggtggatgagatccttgctgcggtacatctcgcggagacgttcggcgcgcgg
atcgtgcgggtgttcgccggcgaccggccgccggagggatacgccttcgacgaagtgaag
gcgtggattgtcgaaggcctgcgcgaagcggcggccgcggccgcggagaaggacatcgtc
ctttgcctggagaaccacggcgtcttcgcgggccaagccgggcaggtccaggcgatcctc
gacgaggtcggctcgccgtacctgcgcagcaccttcgacacggggaacttcctgctcgtc
ggtgaagaccccacagcggccctggaagccctgggcccgcaggtggcgcacgttcacttc
aaagacttcgttcccgtggacgaaggctatgcaggccgggcttacaccggccttacgggc
gagcggttcgccggccgaatcgccggcgagggcatgatcgacctgccggggctgctcggc
cgcctgcatcaggacggctaccgaggctggctcacggtcgagtacgaaggcgacgatgag
cagaagctcggggcggccggctctctcgccaacctggcccgcatcctcgaagggctgccg
gcataa

DBGET integrated database retrieval system