KEGG   Paenibacillus mucilaginosus KNP414: KNP414_07350Help
Entry
KNP414_07350      CDS       T01550                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pms00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    KNP414_07350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pms03400]
    KNP414_07350
Enzymes [BR:pms01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     KNP414_07350
DNA repair and recombination proteins [BR:pms03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     KNP414_07350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_ligase_C
Motif
Other DBs
NCBI-ProteinID: AEI45857
UniProt: F8FPP0
LinkDB All DBs
Position
8045518..8046468
Genome map
AA seq 316 aa AA seqDB search
MEWQPIVPFEPIRTETAPSGDGWVGQIKWDGTRILTYASGGTVRLFNRKGHERTLQYPEL
LDLSSYCTAESVILDGEVIAIADGRPNFQEVMRRDSVRKAQHLALAQKQVPISYMIFDMP
YLDGEWITDKPLRERQRLLQERVRGNATVQLVPSVAGMNDLFGVMKQHKMEGIVCKDLES
KYLIGGKDKRWQKMKIYNDLVAVVGGVTHRAGQVNALMLGLYDAEGRLWYIGHAGAGRFT
QQTWRELTEKVREMTLPERPFVNVPERSKDAVWIKPVLTVKVSYMEWTAGRTLRQPSIQA
LVGAQPADCTFGQLDG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttggaatggcagcccatcgttccgttcgagcccatccgcaccgaaaccgcgccctccggg
gacgggtgggtcgggcagatcaagtgggacggcacccgtattctcacctatgcttccggc
ggcaccgtcaggctcttcaaccgcaagggccatgaacggacgctgcagtaccccgagctg
ctcgacctgtcctcctactgcaccgccgaatcggtcattctggatggagaggtcattgcc
atcgcggacgggcgcccgaacttccaggaggtcatgcggcgcgacagcgtccgcaaggcc
cagcacctggcactggcgcagaagcaggtgcccatctcctacatgatcttcgacatgccg
tatctggacggggaatggatcaccgacaagccgctgagagagcggcagcggctgctgcag
gagcgggtccgcggcaatgccaccgtgcagctggtgccgagtgtcgccggcatgaacgac
ctcttcggcgtaatgaagcagcacaagatggagggcattgtctgcaaggatctcgagagc
aaatatctgatcggcggtaaagacaagcgctggcagaagatgaagatctacaacgatctg
gtggcggtcgtcggcggggtcacccaccgggcgggccaggtcaacgcgctgatgctcggc
ctgtacgacgccgaaggccggctgtggtatatcggccacgccggtgccgggcggttcacc
cagcagacttggcgggagctcacggagaaggtgcgggagatgaccctgcccgagcgcccg
ttcgtcaacgtgcccgaacggagcaaggatgcggtgtggatcaagcccgtgctcacggtt
aaagtgagctatatggaatggaccgccggccggacgctgcgccagccgagcatccaggct
ctggtcggcgcccagccggccgactgcacgttcgggcagctggacggctga

DBGET integrated database retrieval system