KEGG   Paenibacillus mucilaginosus KNP414: KNP414_07472Help
Entry
KNP414_07472      CDS       T01550                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
pms00620  Pyruvate metabolism
pms00680  Methane metabolism
pms01100  Metabolic pathways
pms01120  Microbial metabolism in diverse environments
pms01200  Carbon metabolism
Module
pms_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KNP414_07472
  09102 Energy metabolism
   00680 Methane metabolism
    KNP414_07472
Enzymes [BR:pms01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     KNP414_07472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: AEI45975
UniProt: F8F7G6
LinkDB All DBs
Position
complement(8177852..8180641)
Genome map
AA seq 929 aa AA seqDB search
MSDSVSLIHKNTSNNLLRRDVRFLGHILGEVLVHQGGNALFTIVEKIREMSKTLRADYTP
EMYAELKETVTGLAPEIRHQVIRAFAVYFQLINIAEQNHRIRRKRDYERTAGENVQPGSI
EDSVRELKSLGISSDEVQEMIQGISLELVMTAHPTEATRRAVLDIHQRIAGDVMELDNPN
LTFREREQLREKLLGEVITLWQTDELRDRKPTVIDEVRNGLYYFDETLFDVLPEVYQELE
RCLDKYYPEEDWHVPTYLKFGSWIGGDRDGNPSVKASVTWETLTMHRKLALAKYEEELTG
LLEHMSFSRSIVEVSEELLESIEKDRREIELSSDNEWRNLKEPYRIKVKFMTERIRNTGN
PNAPAKRKYNNPDEFRADLQIIERSLRNHYADFIADTYVQKLVRQVELFGFHLAALDVRQ
HSKEHEAAMTEILAKMSICEDYSKLPEAEKIELLTAILNDPRPITSPYLRYSESTQECLD
VYRVIQKAQQEFGRSCISSYLISMTQGASDLLEVLVFGKEAGLYIHENDGSITCTLQSVP
LFETIDDLHAAPDIMTTLFKIPAYRNSLVSTNHLQEIMLGYSDSNKDGGVITANWELRVA
LRGITAAAKPFDVKLKFFHGRGGALGRGGMPLNRSILAQPADTVGGGIKITEQGEVLSSR
YSMKGIAYRSLEQATSALITSALQARNPQTNASEAEWENIMRGISEQAQTKYQDLIFRDE
DFLTFFKESTPLPEIGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAAGY
GLNSFYAGKKENLQKMQEMYQNWSFFRSLIDNLQMALAKADLLIAKEYGSMIQDQSIAER
IFGLIQDEYTRTSELILNITGQQEILDNVPVIQESIRLRNPYVDPLSYMQVGLLSELRTL
RDQGEDDALLLREVLLTINGIAAGLRNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgtcggattcagtcagtttaattcacaagaacacgtccaacaatttgcttcgccgggat
gtccggtttctggggcacattttgggtgaagtgctggttcaccagggcggcaatgcgctg
tttaccatcgtagagaaaatcagagagatgagtaaaacgctgcgcgccgattatacgccg
gagatgtacgccgaactgaaagaaaccgtgacgggcctggcgccggaaattcgtcaccaa
gtcatccgtgctttcgcggtgtacttccagctgatcaatattgccgagcagaaccaccgg
atccgccgcaagcgcgattacgagcggacggccggagagaacgtgcagccgggctccatc
gaggattcggtccgcgagctgaagtcgctgggcatttcgtcggacgaagtgcaggagatg
attcaaggcatctccctggagctggtcatgaccgcccacccgacggaagcaacccgccgc
gccgtgctggatattcaccagcgcatcgcaggtgacgttatggagctcgacaacccgaac
cttacgttccgggagcgggagcagctgcgcgagaaactgctgggtgaggtgattaccctc
tggcagaccgatgagctgcgcgaccgcaagccgaccgttatcgacgaagtccgcaacggt
ctgtactatttcgacgaaacgctcttcgatgtgcttcctgaagtctatcaggagctggag
cgctgtctggacaagtattatccggaagaggactggcatgtgccgacttacctgaagttc
ggctcctggatcggcggcgaccgggacggcaacccttccgtcaaggcttccgttacgtgg
gagaccctgaccatgcaccgcaagctggctctcgcgaaatacgaggaggagctgacgggg
ctgctggagcacatgagcttcagccggagcatcgttgaagtcagcgaggagcttctcgag
tcgatcgagaaggatcgccgcgagattgagctttcctcggataacgagtggcgcaacctc
aaggagccttaccgcatcaaagtgaaattcatgaccgagcgcatccgcaatacgggcaac
ccgaatgcacccgcgaagcgcaaatacaataacccggatgaattccgtgcagacctgcag
atcatcgagcgcagcctccgcaaccactatgcggacttcatcgccgatacgtatgtacag
aagctcgtccgccaagtggagctgttcggcttccatctggctgcactggatgtgcgtcag
cacagcaaggagcacgaagcggccatgacggagatcctggccaagatgagcatctgtgag
gactactcgaagcttccggaagccgagaagatcgaactgctcacagcgattctgaacgac
ccgcgtccaattacttcaccttacctgcggtacagcgaatcgacgcaggaatgcctggac
gtctaccgtgttatccagaaagcacagcaggagttcggccgcagctgtatttcgagctac
cttatttcgatgacccagggcgcaagcgacctgctcgaagtgctcgtcttcggcaaggaa
gcggggctgtacatccacgagaatgacggctccatcacatgtaccctgcagtccgtgcct
ctgttcgagacgatcgacgacctgcacgccgctccggacatcatgacgaccctcttcaag
attccggcttaccggaattcgctcgtgtcgacgaaccacctgcaggagatcatgctcgga
tactccgacagcaacaaggacggcggcgtcatcaccgccaactgggagctgcgggtagcc
ctgcgcggcattacggcagcggctaagccgttcgacgtgaagctgaagttcttccacggc
cgcggaggggcgctgggccgcgggggcatgccgctcaaccgcagcatcctggcccagcct
gccgatacggtcggcggcggcatcaagatcacggagcagggcgaggtgctttcctcccgc
tattcgatgaagggcatcgcctaccgctccctggagcaggcgacttccgcgctcattacg
agcgcgctgcaggctagaaatccgcagacgaacgcttccgaagcggaatgggagaacatc
atgcgcggcatctccgagcaggcgcagacgaagtaccaggacctgatcttccgggacgag
gacttcctgacgttcttcaaagagtctacgccgctgccggagatcggcgaactcaacatc
ggctcccgtccttccaagcggaagaacagcgaccggtttgaggatctgcgcgcgattcca
tgggtgttcgcatggacgcagagccgttacctgctgccggcctggtacgctgccggctac
gggctgaacagcttctacgcaggcaagaaagagaaccttcagaagatgcaggagatgtac
cagaactggtcgttcttccgttccctgatcgacaatctgcagatggccctggccaaagcg
gatctgctcatcgccaaggaatacggcagcatgatccaggatcaaagcatcgccgagcgt
atcttcggattgatccaggatgagtacacccgtacctcggagctcatcctgaacatcacc
ggacagcaggagattctggataacgtaccggtcatccaggaatcgatccgcctgcgcaac
ccgtatgtcgatccgcttagctacatgcaggtagggctgctctccgagcttcgcaccctg
cgggatcaaggcgaagacgatgcgctgctgctccgcgaagtgctgctgaccatcaacggc
attgcagcgggcctgcggaatacgggctga

DBGET integrated database retrieval system