KEGG   Prochlorococcus marinus MIT 9313: PMT_0208Help
Entry
PMT_0208          CDS       T00143                                 

Definition
(GenBank) Delta 1-pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
pmt00330  Arginine and proline metabolism
pmt01100  Metabolic pathways
pmt01110  Biosynthesis of secondary metabolites
pmt01130  Biosynthesis of antibiotics
pmt01230  Biosynthesis of amino acids
Module
pmt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pmt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PMT_0208
Enzymes [BR:pmt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     PMT_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored
Motif
Other DBs
NCBI-ProteinID: CAE20383
CyanoBase: PMT0208
CYORF: PMT0208
UniProt: Q7V8W5
LinkDB All DBs
Position
238669..239511
Genome map
AA seq 280 aa AA seqDB search
MASNHSMPCSLGVIGLGRMAQALVLPLLKQGELAPQQLVAVVGCGASVERLADQLPIGLR
LKAADDPTAAEAWMAPIQLLAVKPQQLDQIAASAARLKKTADGPHLLISVLAGVSLARLQ
QAFPAHACVRAVPNTPALVGAGLTGLSWGEGVTPEQRLAVERLFLPVSEVLELPESQLDA
FLALTSSGPAYVALVAEAMADGAVAAGLPRSLAHHLAHRTLAGTAALLKQQKLHPAELKD
MVTSPGGTTIAALRKLERAGVRSALIEAVVAAAQRSRELA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtggcctctaatcactccatgccctgctctttgggggtaatcggcctgggtcgaatggcc
caggctcttgttttgccgttgttgaagcagggagagcttgctccgcagcagcttgttgcg
gttgtgggctgtggcgcaagtgttgaacgtctcgcagatcagttgccaatcggtctgcgt
ttgaaagctgcagatgatcccactgcggcagaggcatggatggcgcccattcaattgcta
gcggtgaaaccgcagcagcttgaccagatagcggcttcagcagctcgtcttaagaaaact
gcagatgggccgcacctgttgatttctgtgcttgctggcgtgagcttggcgcgtttgcag
caggctttccccgctcatgcctgtgtgcgtgccgttccaaatacccctgccttggttggc
gctgggcttactggattgtcttggggagagggcgtcacgccagagcaacgcctagcggtt
gagcgattgtttttgccggtgagcgaggtgctggaattgccggagtcgcagctggatgct
tttttggcgttgacgtcatccggccctgcctatgtggcactggtggctgaggcgatggct
gatggtgcagtagcggcaggcctgccgagatccttggcccatcatcttgcccatcgcacc
cttgctggcacagccgccttgcttaagcagcagaaactgcatcctgcggagcttaaagac
atggtgacctctccgggtggcaccacgattgccgcactgcgcaagcttgagcgggcaggg
gttcgttctgctttgattgaggcggttgttgcagctgctcaacgtagccgtgaactggct
tga

DBGET integrated database retrieval system