KEGG   Prochlorococcus marinus MIT 9313: PMT_0474Help
Entry
PMT_0474          CDS       T00143                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
pmt00250  Alanine, aspartate and glutamate metabolism
pmt00410  beta-Alanine metabolism
pmt00430  Taurine and hypotaurine metabolism
pmt00650  Butanoate metabolism
pmt01100  Metabolic pathways
pmt01110  Biosynthesis of secondary metabolites
pmt01120  Microbial metabolism in diverse environments
pmt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PMT_0474
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PMT_0474
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PMT_0474
   00430 Taurine and hypotaurine metabolism
    PMT_0474
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PMT_0474
Enzymes [BR:pmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PMT_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAE20649
CyanoBase: PMT0474
CYORF: PMT0474
UniProt: Q7V891
LinkDB All DBs
Position
complement(526282..527721)
Genome map
AA seq 479 aa AA seqDB search
MALHRSNPRSNDLEEHAIGETVDALVSPLPRTTFPQEYRPALTTFNLLKEELLLDGNSKQ
NLATFCQTYESQQVAELMALAVDKNLIDKDEYPQTAEIERRCVSMMADLWHAPGEAVGCS
TIGSSEAAMLGGLAAKWRWREHRKAAGQSIDRPNMVCGSVQICWTKFARYWDVELREVEM
TSGELCMSPERMLEQVDENTIVVVPTLGVTYHGLYEDVQAVSQALDELQQRKGLDIPIHV
DAASGGFLAPFCAPDLAPWDFRLPRVKSINSSGHKFGLAPLGVGWVLWRESRDLPEGLVF
HVSYLGGDMPTFQINFSRPAGQVISQYYDFVRLGRDGYQAIHGASYANAQYVAQELKKLG
PFELINDGNPAGGIPTVVWTLRADQELGFNLYDLSDRLRLRGWQVPAYPFTGELAHQAFQ
RILVKRDFSREMADLLLTDIRNAITHFESHPVKISLNANEAASTNHLGRSMVECRDAHG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcatcgttccaatccccgctccaacgatctggaagaacatgccattggggaa
accgttgatgcattggtctcaccattaccacgcacgactttcccgcaagagtaccgtcct
gcattaacaacatttaatttgctcaaggaggaattattgcttgacggcaacagcaaacaa
aatctggccaccttctgtcagacctatgaaagccaacaggtggctgagctaatggccctc
gcggttgacaagaacctgatcgacaaggacgaatatccccaaaccgcagagattgaacgc
cgttgtgtttcgatgatggctgatttatggcatgcccccggtgaagctgtgggctgctcc
accattggtagcagtgaggccgccatgctgggtggcttggctgcgaaatggcgttggcgt
gaacatcgcaaagcggcaggtcagtcgatcgatcgccccaacatggtttgcggcagtgta
caaatctgctggacgaaatttgcccgctactgggacgttgagttgcgggaggtggagatg
acctccggcgagctctgcatgtctccagaacgaatgctggagcaagtggatgagaacacc
atcgttgtggtacctaccctgggcgtcacttatcatggcctgtatgaagacgtacaagcc
gtcagtcaggccctcgatgagctgcaacagcgaaaaggactcgacattcctatccatgtg
gatgcagccagcggtggctttcttgctcctttctgtgcccctgatctagctccctgggat
ttccgcttgccgcgcgtgaagtcaatcaactcctctggccataagttcggcttagctcct
ctgggtgtgggttgggttctttggcgtgagtcccgtgatctaccggaaggattggttttc
catgtgagttacctaggaggcgatatgccaacgtttcagatcaacttctcgcggccagcg
gggcaggtgatctcccagtactacgactttgtccgcctaggtcgcgatggttatcaagcc
atccatggagcgagctatgccaatgctcaatatgttgctcaagaactcaaaaagctaggc
ccatttgagttgataaacgatggcaacccagcaggtggcatccccacggtggtatggaca
ttgcgagccgaccaagagcttggttttaacctttacgacctctctgatcgactgagatta
cgtggttggcaagtgccagcttatccattcacaggtgagcttgctcatcaagcctttcag
cggatcttggtaaaacgcgatttctcacgtgaaatggctgatctcctacttaccgacatc
cgcaacgccataactcatttcgagagtcatcctgtcaagatcagtcttaacgctaatgaa
gcagcgtctactaatcatctcggccgttcaatggttgaatgccgtgatgcgcatggatga

DBGET integrated database retrieval system