KEGG   Prochlorococcus marinus MIT 9313: PMT_1205Help
Entry
PMT_1205          CDS       T00143                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase, large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
pmt00630  Glyoxylate and dicarboxylate metabolism
pmt00710  Carbon fixation in photosynthetic organisms
pmt01100  Metabolic pathways
pmt01120  Microbial metabolism in diverse environments
pmt01200  Carbon metabolism
Module
pmt_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmt_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmt_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PMT_1205
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMT_1205
Enzymes [BR:pmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     PMT_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CAE21380
CyanoBase: PMT1205
CYORF: PMT1205
UniProt: Q7V6F8
LinkDB All DBs
Position
complement(1293386..1294798)
Genome map
AA seq 470 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPREEVAAAVAAESSTGTWST
VWSELLTDLEFYKGRCYRIEDVPGDKESFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPMAFIKTCGGPPNGIVVERDRLNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDLTKDDENINSQPFQRWRERFEFVAEAVKLAQQETGEVKGHYLNCTATTPE
EMYERAEFAKELDMPIIMHDYITGGFTANTGLANWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDNLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALLAIFGDDSCLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAAKHSPELAIALETWKEIKFEFDTVDKLDVQ
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtatgacgcaggggttaaggagtacagagacacctactggactcccgat
tatgtacccctagacactgacttactggcctgttttaaatgcactggccaggaaggagta
cccagagaggaagttgctgcggctgtagcggctgaatcttcaaccggtacttggtccaca
gtttggtcagagctattaactgatcttgaattttacaagggccgttgctatcgcatcgag
gatgtccctggagacaaggagtccttttacgcttttattgcttaccctctagaccttttt
gaagaaggttcaatcactaacgttctgacctctttggtcggtaatgtttttggcttcaaa
gcattacgccatctgcgtttagaagatatccgcttcccgatggccttcatcaagacatgc
ggtggtcctcctaatggcattgtcgtagaacgtgatcgtttgaataagtacggtcgcccc
ttacttggttgcaccattaagccaaagcttggcctttctggtaaaaactatggacgggtt
gtttatgagtgtctgcgtggtggtcttgacttaaccaaagacgacgaaaacatcaactct
cagcctttccagcgttggcgcgagcgctttgagtttgttgctgaggctgtcaagcttgca
cagcaagaaacaggagaagtcaaaggtcattatctcaattgcactgcgacaactcctgag
gagatgtatgagcgtgctgagttcgctaaagaactcgacatgccaatcatcatgcatgac
tacatcactggtggatttaccgctaacacaggtttggcgaattggtgccgtaaaaacggc
atgctgttgcatatccaccgcgccatgcatgcggtgattgaccgtcatcccaagcatgga
attcacttccgtgtgcttgccaagtgcctgcgtctttccggtggagatcaactccataca
ggaactgtggttggcaagctggaaggtgatcgtcagaccactcttggttatatcgacaac
ctgcgtgagtcttttgttccagaagatcgcagtcgcggtaacttctttgaccaagactgg
ggttccatgcctggtgtttttgctgtggcctctggtggtatccacgtttggcatatgcca
gcattgttggcaatttttggagacgactcctgtctacagtttggtggtggtactcatggt
catccatgggggtctgctgctggtgccgcggctaaccgagtggcacttgaagcctgtgtg
aaagcacgcaatgccggtcgtgagatcgagaaggaaagtcgcgacatccttatggaagcg
gcgaagcatagccctgagctggccatcgcacttgagacttggaaagaaatcaagttcgag
ttcgatactgtcgacaagctcgacgttcagtag

DBGET integrated database retrieval system