KEGG   Prochlorococcus marinus MIT 9313: PMT_1217Help
Entry
PMT_1217          CDS       T00143                                 

Definition
(GenBank) Protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
pmt00860  Porphyrin and chlorophyll metabolism
pmt01100  Metabolic pathways
pmt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PMT_1217
Enzymes [BR:pmt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     PMT_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH AAA_31 CbiA ArsA_ATPase ParA AAA_24 SRP54 MeaB MipZ AAA_26 NB-ARC AAA_16 AAA_25 CBP_BcsQ RNA_helicase AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: CAE21392
CyanoBase: PMT1217
CYORF: PMT1217
UniProt: Q7V6E7
LinkDB All DBs
Position
1305102..1305992
Genome map
AA seq 296 aa AA seqDB search
MTTTLTRPADGEGSVQVQQDASVRIQEGALVIAVYGKGGIGKSTTSSNLSAAFSKLGKRV
LQIGCDPKHDSTFTLTHRMVPTVIDILEEVDFHSEELRPDDFMFEGFNGVKCVESGGPPA
GTGCGGYVTGQTVKLLKEHHLLEDTDVVIFDVLGDVVCGGFAAPLQHANYCLIVTANDFD
SIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNQQTGLKTMAHFKNVDAIRR
SRLKKCTIFEMDSSDEGVMECQNEYLSLAQKMLDNVEPLEAEPLKDREIFDLLGFD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaccctgacacgaccagccgatggtgaaggcagtgtgcaagttcaacaggat
gcttctgttcgcattcaggaaggggccctggtaatcgcggtctatgggaaaggcggaatt
ggtaaatccaccacctcctccaatctttcagccgcattctccaaactcggcaagcgagta
ctgcaaattggttgtgatcccaagcacgacagtacgttcacgcttacgcatcgcatggtg
cctacggtgatcgacatccttgaagaggttgatttccatagcgaagagttgcgaccagat
gacttcatgtttgaaggcttcaatggagtcaagtgtgtcgagagtggggggcctccagcc
ggcaccggttgcggtggttacgtgactgggcagaccgtaaagctgcttaaagagcatcac
ctgctggaagacaccgatgtggtgatcttcgatgtccttggagacgtggtgtgtggcggc
ttcgctgcacccttgcaacatgccaactactgcttaatcgtcaccgctaacgactttgat
tcgatctttgcgatgaatcgcattgtcgctgcaattaacgccaaagctaagaactacaaa
gttcgccttggcggagtcattgcaaatcgttctgccgaattagatcaaatagaaaaattt
aatcaacagacagggctgaaaactatggctcattttaaaaacgttgatgcaatacgtaga
tcaagacttaagaaatgcacaattttcgagatggactcatcagacgagggggtaatggaa
tgtcaaaatgaatatctttcactagcacaaaaaatgctcgataatgttgagcctcttgaa
gcggaacctctcaaagatcgtgaaatttttgacctacttggctttgactaa

DBGET integrated database retrieval system