KEGG   Prochlorococcus marinus MIT 9313: PMT_1713Help
Entry
PMT_1713          CDS       T00143                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pmt  Prochlorococcus marinus MIT 9313
Pathway
pmt00620  Pyruvate metabolism
pmt00680  Methane metabolism
pmt00710  Carbon fixation in photosynthetic organisms
pmt01100  Metabolic pathways
pmt01120  Microbial metabolism in diverse environments
pmt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PMT_1713
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PMT_1713
   00680 Methane metabolism
    PMT_1713
Enzymes [BR:pmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PMT_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAE21888
CyanoBase: PMT1713
CYORF: PMT1713
UniProt: Q7V561
LinkDB All DBs
Position
1813328..1816342
Genome map
AA seq 1004 aa AA seqDB search
MIMAKPESTSASMQQSSAQKTDCEQPRAIGEGQQAGRLLQNRLELVEDLWQTVLRSECPP
DQAERLLRLKQLSEPLALEGADENSASRAIVLLIQEMDLAEAITAARAFSLYFQLVNILE
QRIEEDSYLASMSSGKENNRQDKPYDPFAPPLATQTDPATFRELFERLRRLNVPPAQLET
LLQEMDIRLVFTAHPTEIVRHTVRHKQRKVASLLQQFQSDPTKSTSEKESLRLQLEEEIR
LWWRTDELHQFKPSVLDEVDYALHYFQQVLFDAMPQLRRRLITAMAESYPDVHIPQAAFC
TFGSWVGSDRDGNPSVTPEITWRTACYQRQLMLERYVNAVQKLRDQLSISMQWSQVSTPL
LESLEMDRLRFPEVYEERAARYRLEPYRLKLSYTLERLKLTQHRNQQLAEAGWQTPPEGL
NPSPNLINAGEALHYKSVAEFRSDLELIRNSLVSTDLSCEPLDTLLNQVHIFAFSLASLD
IRQESNRHSDALDELTRYLNLPKAYGDMAENERVQWLMEELQTRRPLIPSAVIWSPSTAE
TVAVFRMLHRLQEEFGSRICRTYVISMSHTVSDLLEVLLLAKEAGLVDPAAGHAELLVVP
LFETVEDLQRAPAVMEALLSSPVYRNLLPRVSEQVQPLQELMLGYSDSNKDSGFLSSNWE
IHQAQIALQDLANRQGVALRLFHGRGGSVGRGGGPAYQAILAQPSGTVRGRIKITEQGEV
LASKYSLPELALYNLETFTTAVLQNSLVTNQLDATPSWNQLMTRLAGRSREHYRALVHNN
PDLVAFFQQVTPIEEISKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWFGV
GTALAAEVESDADQLDLLRRLHQRWPFFRMLISKVEMTLSKVDLDLAHHYMTSLGREDYR
EAFNRIFEIIETEYSLTRRLVLNITGQPRLLAADPALQLSVDLRNRTIVPLGFLQVALLR
KLRDQNRQPPMNDAGDGRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atgatcatggccaaacctgagtccactagcgcatcgatgcagcagtcttccgcccaaaaa
actgattgcgaacaacccagagcaatcggagaagggcagcaggcaggacgcttactgcag
aaccgccttgaactggtggaagacctttggcaaacggtactacgcagcgaatgtccaccg
gatcaggcagaacgactacttcgactgaagcaactcagtgaacctttggcccttgaaggt
gcagatgagaacagtgccagcagagcaatcgtgctgttgatccaagagatggacctggca
gaagcgatcaccgcagcacgcgccttctccctctatttccaactggtgaatatcctcgaa
caacggatcgaggaagacagctacctcgcaagtatgtcctctggcaaagaaaacaaccgc
caagacaaaccctatgacccctttgctccaccgctcgccacgcagacagacccagccaca
ttcagggagctgttcgaacgacttcgccgtctcaacgtgccaccagctcagctggagacc
cttctacaggagatggatatccgcctagttttcactgctcatcccactgaaatcgtccgt
cataccgttcgccataagcaacgcaaggttgcaagcctgttgcagcagtttcaatcagat
ccaacaaaatcgacatctgagaaagaaagcctgagactgcagcttgaggaggagatcagg
ctctggtggcggaccgatgagcttcatcagttcaagccctccgttctggatgaggtggat
tacgccctccactatttccaacaggtgctttttgatgccatgccccagctacggcgtcgc
ctgatcactgcaatggccgagagctatccggacgtacacattccacaagctgccttctgc
acgtttggatcttgggttggatcagaccgagacggcaatccttccgttacgccagaaatc
acctggcgcaccgcctgttatcaacgtcagctgatgctggagcgctatgtcaatgccgtt
caaaaactccgtgatcaactcagcatctccatgcaatggagccaggtaagtactccactg
ttggagtcactggaaatggaccggcttcgattccccgaggtttacgaggaacgcgcagcc
cgctatcgactcgagccttatcgcctcaaactcagctacaccctggagaggttgaaactc
actcaacatcgcaaccagcaattggccgaagcaggctggcaaaccccaccagaaggccta
aaccccagccccaatctaattaatgcgggagaagcccttcactacaaatcagtagcagaa
ttccgcagcgacctagaactgatccgcaacagcctggtcagcacagatctgagctgtgag
cctctggataccctcttaaatcaggtccacatcttcgctttctcactagccagccttgac
atccgccaggagagcaatcgccatagcgatgctctcgacgaattaacccgctacctaaac
ctccctaaggcctatggcgacatggccgaaaatgagcgagtgcaatggttaatggaggaa
ctacagactcgccgccccctgatcccctctgccgttatctggtcgcccagtacagccgaa
acggtggccgtgtttcgcatgctgcaccgactgcaggaggaattcggcagccgaatctgc
cgcacatatgtgatctcaatgagtcacacagtttccgatctactcgaggtgctgctgcta
gccaaagaagccggcctcgtggatccggctgctggccatgccgaactgcttgtggtgccc
ctcttcgaaaccgtagaggatctccagcgggctccagcagtaatggaggcacttttgagt
tcacctgtctaccgcaatttgctccctcgtgtcagcgaacaggtccaacctctgcaggag
ctgatgcttggctattcggacagcaacaaagactccggatttctatccagcaattgggag
atccatcaagcccaaattgccctgcaagatctagctaaccgccagggtgtggctctgcgc
cttttccatggacgcggtggatctgttggcagaggaggtggccctgcctaccaagcaatc
cttgcccaaccaagcggaaccgtgcgcggccgaatcaagatcactgagcagggagaagta
ctggcatcgaaatacagcctgcccgagctagccctttacaacctagaaacattcacaacg
gctgtcctgcaaaacagtctggtaaccaaccagctagatgccaccccaagttggaatcaa
ctgatgaccagactggctggccgttcacgtgagcactatcgggccctcgtccacaacaac
cctgatctggtggccttcttccaacaggtcacgccgatcgaagaaatcagcaaattgcaa
atctccagccgtcctgctcgacgcaaaagcggcgccaaggacctctctagcctgagagcg
atcccctgggtatttggctggacgcaaagtcgattcctgctaccgagctggtttggcgtt
ggaacagccttagccgctgaagtcgaatcagacgctgaccagcttgaccttctacgcaga
ctgcaccaacgctggccattcttccgaatgctgatctccaaggtggagatgaccctttca
aaagtagacctagacctggcccatcactacatgactagccttggccgcgaagattaccgt
gaagcctttaaccgtatcttcgagatcatcgaaacggagtacagcctcacccgccggttg
gtcttaaacatcacaggacaacccaggttgctcgcggccgatcccgccctacagctatca
gtagatcttcgcaatcgcacgatcgtgccccttgggtttctgcaagtggccctgcttcgc
aagctgcgtgatcagaaccggcagccacccatgaacgatgctggcgatggtcgcacttac
agccgcagcgaactgctaagaggcgcactgctcaccattaacggcattgctgcaggcatg
cgcaacaccggttga

DBGET integrated database retrieval system