KEGG   Pasteurella multocida subsp. multocida Pm70: PM0339
Entry
PM0339            CDS       T00046                                 

Gene name
fabB
Definition
(GenBank) FabB
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00061  Fatty acid biosynthesis
pmu00780  Biotin metabolism
pmu01100  Metabolic pathways
pmu01212  Fatty acid metabolism
pmu01240  Biosynthesis of cofactors
Module
pmu_M00083  Fatty acid biosynthesis, elongation
pmu_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PM0339 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PM0339 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pmu01004]
    PM0339 (fabB)
Enzymes [BR:pmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     PM0339 (fabB)
Lipid biosynthesis proteins [BR:pmu01004]
 Fatty acid synthase
  Component type
   PM0339 (fabB)
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Other DBs
NCBI-ProteinID: AAK02423
UniProt: Q9CNT6
LinkDB
Position
399151..400371
AA seq 406 aa
MKRAVITGFGIISSIGNNKDEVLASLKAGKSGIEVMPEFVEIGMRSHVAGTVKLNPSELI
DRKIYRFMGDAAAYAYLSMKEAIEDAGLTEDQVSNDRTGLVIGAGTGSAHNQLIACDAVR
GPRGVKAVGPYAVTKTMASSVSACLATPYKIRGVNYSISSACATSAHCIGHALELIQLGK
QDIVFAGGAEELSWECATEFDAMGAVSTKYNDTPEKASRAYDANRDGFVIAGGGAVVVVE
ELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMRQAMATVDTPIDYINVHGTS
TPVGDVKELGAIKNVFGDKVPAISSTKSMTGHSLGAAGAHEAIYTLLMLDNDFIAPSINI
ETLDENAKGCNIVTETVENAGLKTVMSNSFGFGGTNAALIFKKYQA
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgaaaagagcggttattactgggtttggtattatttcgagtattggcaacaataaagac
gaagtattagcatcgttaaaagctggcaaatcaggtatcgaagtgatgcccgagtttgtt
gagattggcatgcgtagtcatgtggccggcacggttaaattaaatccaagtgagctgatt
gatcgtaaaatatatcgttttatgggggatgcggcagcttatgcttatctttcgatgaaa
gaggcgattgaagatgcaggtttgacagaagatcaagtatcgaacgatcgtactggcttg
gtgattggtgcgggaactggttcagcccataaccaattaatcgcctgtgatgcggtgcgt
ggtcctcgtggtgtgaaagcggtaggaccttatgcggtcactaaaacgatggcatccagt
gtttcagcttgtttagcaacaccttacaaaattcgtggtgtgaactacagtattagttca
gcttgtgcaacatcagcccattgtattggtcatgcgcttgagttaattcaattaggtaaa
caagatattgtgtttgcgggtggcgcagaagaattatcttgggaatgtgcaactgagttt
gatgcgatgggtgcggtatcgacaaaatacaacgataccccagaaaaagcgtcacgcgct
tatgatgcgaaccgtgatggtttcgtcatcgcaggtggtggtgcagtggttgttgttgaa
gaattagagcatgctcttgcacgtggtgcgaaaatttatgctgaaatcgttggctatggc
gctacatcagacggttatgacatggtggcgccaagtggtgaaggcgcggagcgttgtatg
agacaagccatggcgacggttgatacaccaattgattacattaacgtccatggtacttct
acaccagtaggagatgtgaaagagttaggtgcgattaaaaatgtttttggtgataaagtg
ccagctatctcatcaacgaaatcgatgaccggtcactctttaggtgcagcgggtgcgcac
gaagcgatttacacgttattaatgttagacaatgattttattgcgccaagtatcaatatc
gaaactctcgatgagaatgcaaaaggctgtaacattgtgaccgaaactgttgaaaatgcc
ggcttgaaaactgtgatgtcaaatagctttggttttggtggaacaaacgcagcgttaatt
ttcaaaaagtatcaagcataa

DBGET integrated database retrieval system