KEGG   Pasteurella multocida subsp. multocida Pm70: PM1000Help
Entry
PM1000            CDS       T00046                                 

Definition
(GenBank) unknown
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PM1000
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PM1000
Enzymes [BR:pmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     PM1000
Bacterial toxins [BR:pmu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   PM1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 Autotransporter BNR Sortilin-Vps10 OMP_b-brl
Motif
Other DBs
NCBI-ProteinID: AAK03084
UniProt: Q9CM43
LinkDB All DBs
Position
complement(1176085..1179327)
Genome map
AA seq 1080 aa AA seqDB search
MKKFNPSVLALSISSLLLTSTLTFGQIQQQDKALFGVKEHQESLLFHQSLVKQGSDNVPI
WRIPSLLRTKDGVLIAAADKRWQHRGDWGDIDTAIRISHDDGKTWGNITTILDLPSQNTE
HSPVMNTSTNPWGDKDNVIRQRIRDPNYSSQYMNSAFLIDAQMVQDKRNGRVFLAVDMFP
ESAGFFHLNGAFNNPGKDGSGRLTIDGKQYLKLIYQDKQWTLREDGSVFDELNRKTQYKV
IVKGDPNKNFKDLGDVYNENNENIGNIYLTNRKGSKNEKAPFYIPTTSYLWMTYSDDNGK
TWSSPIDISAQIKKDWMRFLGTGPGVGIQTKNGNLIFPVYYTNQNNVQSTALIISKDGGK
SWELGQSPNDKRIELNGMNSHNLRWDSWYANTAKQKGFELTEAQLVELENGELKLFMRNQ
TGKVMMSTSKDGGYTWVNTEKINELDHGYSQLSVIKYSKRINGKEYIVFSGQSRSGQGGD
NLRRDGKLFLGEVQESGEIKWDTTNLVREIVSQGKAAGQPNGYVYSSMAELGDGSIGLAY
ENTTDYTTIMYLPIEMQEFFWKAGKIFSDVRQKEPLVFTYDGTETLEKIGDGIAIKRGEG
ESQSGINVSEGLLVLDQQTKDGKNKAFTQLTLNNSGVAQVNSTQNIDRFVVNNGATGYLQ
FTVTDTHSPRLKINQDVTAHGQIVAVQVNLQKKLKPNDKGYYHAQGEELIAFKDNGQVKW
RLVNDELKDGMYVYTLASVAKPSVLRTTSQPHSLYLTNKLITADGKAVSTVSPLKAPLTV
NARPQVNPVLASYLTANLALNKMSEQLQQSFMHETRLLQEKDRSIFVKYLNGKQKYGSNL
SFIDYGYDFNASYSGVMLGGKVWQSERGNHALYTALNKTSYKVTPKAVDGETKAKYHSWG
GSINWHSNLPHNLIVDLSAGYQKHKGDIEHAGHVKGYTFNIGADLGYRYQWMKNAFITPM
VGLHYLYASLSDVNDQANKALLKYNNFNALKTNLGVDVNYRIGKFEVKGLLSYDMYQQKT
RQLYVDDVAYKQGKLADTLHLNTQFVAHLTPRFAFSTEVGFQHARNKGQSSFAVGAHYQF
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttaatcctagtgtattggcgttgtccatatcaagtctgctactcacatcc
acattgacctttggtcaaatccagcaacaagataaagcactctttggtgtgaaagaacat
caagaaagcctactctttcatcagagcttagtaaaacaaggtagtgataatgtgccaatt
tggcgcattccgtctttattaagaacaaaagacggtgtattaattgccgccgcagataag
cgttggcaacaccgtggcgactggggcgatattgataccgcaatccgaattagtcatgat
gatgggaaaacatggggaaatattacaacgattttggatttgccatcacaaaatacagag
cactctccagtaatgaatacatctacaaatccttggggagataaagataatgtgattaga
caaagaatacgtgatccgaattattctagccaatatatgaattctgcgtttctgattgat
gcacaaatggtacaagataagcgtaacgggcgagtctttcttgctgtagatatgtttcct
gaaagtgctggtttttttcatttaaatggtgcttttaataatcctggtaaagatggaagt
gggcgattaactattgatggaaagcaatatttaaagttaatttatcaagataaacaatgg
actttacgtgaagatggtagtgtatttgatgaattgaatagaaaaacacaatataaagtg
attgtaaaaggagatccaaataagaactttaaagatcttggggatgtttataatgaaaat
aatgaaaacatcggcaatatttacttaactaatagaaagggatctaaaaatgagaaggca
cctttttatattccaactacatcatatttatggatgacatactcggatgataatggaaag
acatggtcttcacctatagatatttcggcacaaattaaaaaagattggatgcgattttta
gggaccggaccaggagttggtattcaaactaaaaatgggaatttaattttccctgtttac
tatacaaatcagaataatgttcaatcaacagctttaattattagtaaggatggcggaaaa
agctgggagttaggacaaagtcctaatgataaaagaatagagttaaatggtatgaactca
cataatttaagatgggatagttggtatgctaatacagctaaacaaaaaggttttgaatta
acagaagcacagcttgttgagttagagaatggtgagcttaagctatttatgagaaatcag
acaggtaaagttatgatgtctacttctaaagatggaggctacacttgggttaatactgaa
aaaattaatgaattagatcacgggtattctcagctttcagtaattaaatactctaaacga
attaatggtaaagagtatattgtattttctggtcaatctcgtagtgggcaagggggagat
aatctccgtagagatgggaaacttttcttaggagaagtgcaagaaagtggtgaaataaaa
tgggatacaactaatttagttagggaaatcgttagtcaaggtaaagcagcaggacagcca
aacggctatgtctatagctcgatggcagagttgggtgatggcagtattggtttagcttat
gaaaatacgacagactacaccacaatcatgtatctccctattgaaatgcaagaatttttt
tggaaagccggaaaaatctttagtgatgtgcgtcagaaagaaccattagtgtttacttat
gatggaacggagacattggaaaaaattggcgatgggattgcgattaaacgtggtgaaggg
gaaagtcaaagtggaattaatgtgagtgaaggcttgcttgtgttggatcagcaaacgaaa
gacggtaaaaacaaagcctttactcaacttacccttaataactcgggagtagctcaagtt
aattccacacaaaatattgatcggttcgttgtgaacaacggtgctacggggtatttgcaa
tttacggtcacagatactcactctccacgacttaagattaatcaagacgtgactgcacat
gggcagattgtggctgtacaagtcaacctacagaaaaaactcaaaccaaatgataaaggt
tattaccatgcccaaggagaagaactaatcgcatttaaggataatggacaagtcaaatgg
cgtttagttaacgatgaactaaaagatggcatgtatgtttatactttggcttcagtggct
aaaccaagtgttttacgtacaacaagtcagccacattcactctatttaacaaataagtta
attacagcagatggtaaagccgtatccacagtttctccattgaaagcaccattaaccgta
aatgctcgcccacaagtgaatccggtattagcttcttatttaaccgccaatcttgcgctt
aataaaatgagcgagcaacttcagcaaagttttatgcatgaaacgcgtttattgcaagaa
aaagatcgcagtatttttgttaagtatcttaatggtaaacaaaaatatggctcaaactta
agctttattgactatgggtatgattttaatgcgagttatagcggtgtgatgttgggaggc
aaagtatggcagtctgaacgtggtaaccatgccctgtatacagcattgaataaaacgtcc
tataaagtgacgccgaaagctgtagatggtgagacgaaagcgaaataccacagctgggga
ggaagtataaattggcatagtaacttgcctcacaatctgatagtagatttatcagctggc
tatcaaaaacataagggcgacattgaacatgcaggtcatgtgaaaggttatacttttaat
attggtgcggatttaggttatcgctatcaatggatgaaaaatgcgtttattacaccaatg
gtcggtttgcattatttatatgcctcgctttcagatgtcaatgaccaagcgaataaagcg
ttattgaaatataataatttcaatgcgttaaaaacgaatttaggtgttgatgtgaactat
cgaatcgggaagtttgaagtaaaaggtttactttcttatgatatgtatcaacaaaaaaca
cgtcaattgtatgttgatgatgtagcttataagcaaggtaaactggctgatacacttcat
ttaaatacacaattcgttgcccatttaacgccacgttttgcattttcaacggaagttggt
ttccagcatgcgcggaataaaggacagtcttcctttgctgttggagcacattatcagttc
taa

DBGET integrated database retrieval system