KEGG   Pasteurella multocida subsp. multocida Pm70: PM1027
Entry
PM1027            CDS       T00046                                 

Gene name
metX
Definition
(GenBank) MetX
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00270  Cysteine and methionine metabolism
pmu01100  Metabolic pathways
pmu01110  Biosynthesis of secondary metabolites
pmu01230  Biosynthesis of amino acids
pmu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:pmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PM1027 (metX)
Enzymes [BR:pmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     PM1027 (metX)
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Other DBs
NCBI-ProteinID: AAK03111
UniProt: P57897
LinkDB
Position
complement(1209293..1210447)
AA seq 384 aa
MSRYLFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTS
AWVDIENLTRQVICDIGYKHSDMGFDGHSCAVLNAIGKQSSDINQGVDRENPLDQGAGDQ
GIMFGYATNETEVLMPAAITYAHRLMERQAKVRKEGTLPWLRPDAKSQVTLKYEDHKIVG
VDAVVLSTQHCDSISQHDLHEAVMEEIIKPVLPAEWLSKETKYFINPTGRFVIGGPMGDC
GLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLS
YAIGVADPTSIMVETFGTGKVANELLVALVREFFDLRPYGLIKMLDLIQPIYRETAAYGH
FGREQFPWEKVDRAEELRAAAGLK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtctcgttatttattcacttccgaatccgtatcagaaggacatccagataaaattgcc
gatcaaatttccgatgcggtattagacgaaattttaaaacaagatcccaaagcccgcgtt
gcttgtgaaacctatgtaaaaacagggatggcattagtgggtggcgagatcacaacatcg
gcttgggtagatattgaaaacttaacccgccaggtgatttgtgatattggctataaacat
tctgatatgggctttgatggtcattcttgtgccgtgttaaatgcaattggtaaacaatct
tccgatattaatcaaggtgtggatcgtgaaaatccattagatcaaggtgctggtgaccaa
gggattatgtttggttatgccactaatgaaactgaagtgctgatgcctgcagccattact
tatgcgcaccgtttaatggaacgtcaagccaaggtgcgtaaagagggtaccttgccatgg
ttacgtcctgatgcaaaaagccaagtcacgctaaaatatgaagatcacaaaattgttggg
gtcgatgcggtcgtcctttctacgcaacactgtgacagcatttcacaacatgatttgcat
gaagcagtgatggaagaaattattaagcctgttttacctgcagagtggttatcaaaagaa
accaaatatttcatcaacccaacaggacgctttgtgattggtggtccgatgggtgactgc
gggttaacagggcgtaaaattattgtggatacttacggcggtgccgcgcgtcatggtggc
ggtgcattctcgggtaaagatccttccaaagtagaccgctcagctgcttatgcggcgcgt
tatgtggcgaaaaatattgttgctgcggggcttgcagatcgttgcgaaattcaactttcg
tatgcgattggggttgctgatccgacgtctatcatggtggaaacttttggtaccggtaaa
gttgctaacgaattattagtagcattggtgcgtgaattctttgatttacgtccgtacggt
ttaattaaaatgcttgatttaattcagcctatttaccgtgaaacggcggcttatggtcac
tttgggcgtgaacaattcccatgggaaaaagttgatcgtgcagaagaattacgcgctgca
gcaggacttaaataa

DBGET integrated database retrieval system