KEGG   Pasteurella multocida subsp. multocida Pm70: PM1236Help
Entry
PM1236            CDS       T00046                                 

Gene name
tdk
Definition
(GenBank) Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00240  Pyrimidine metabolism
pmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PM1236 (tdk)
Enzymes [BR:pmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     PM1236 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 RNase_E_G DUF2075 AAA_14 SNF2_N AAA_30
Motif
Other DBs
NCBI-ProteinID: AAK03320
UniProt: P57926
LinkDB All DBs
Position
complement(1428333..1428911)
Genome map
AA seq 192 aa AA seqDB search
MAKLYFYYSTMNAGKSTTLLQSSYNYQERDMNTLVYTAAIDDRFGVGKVTSRIGISQEAQ
LFHKESDLFVEIAQHLQQQPLHCILVDEAQFLTKTQVYQLSEVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNDKGEVVRDGAQIQIGGNDSYLS
VCRLHYKEKIAL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactttatttttattattcaacgatgaatgcggggaaatccaccaccttatta
caatcgtcctataactaccaagaacgcgacatgaataccttagtctatacggcagccatt
gatgatcggtttggtgtgggaaaagtaacctcacgtattgggattagccaagaggcacaa
ctgtttcataaagaaagtgatctttttgttgaaattgcacaacatcttcaacaacaacct
ttacattgtattttagtcgatgaggcgcaatttttaaccaaaacacaagtgtatcagctt
agcgaagtggtggataaattaaagattcctgtgctgtgttacggtttacgcacagatttc
caagcagaattgttcgagggaagtaagtaccttttagcgtgggcggatcaattagaagag
ctcaaaaccatttgttattgcggacgtaaagcaaactttgtattacgtttaaatgacaaa
ggggaagttgtacgtgacggtgcgcaaattcaaatcggtgggaatgacagttatctgtcg
gtttgtcgtttacattacaaagagaagattgcactttaa

DBGET integrated database retrieval system