KEGG   Pasteurella multocida subsp. multocida Pm70: PM1547Help
Entry
PM1547            CDS       T00046                                 

Definition
(GenBank) unknown
  KO
K04083  molecular chaperone Hsp33
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Brite
KEGG Orthology (KO) [BR:pmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pmu03110]
    PM1547
Chaperones and folding catalysts [BR:pmu03110]
 Heat shock proteins
  HSP33
   PM1547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AAK03631
UniProt: Q9CKQ9
LinkDB All DBs
Position
1749788..1750654
Genome map
AA seq 288 aa AA seqDB search
MTDNTDNDKLYRYLFQDRAVRGEWVRLNQTFTDTLNTHQYPKVIQNLLGEMMVATSLLTA
TLKFEGDITVQVQGDGPLKLALVNGNHQQQIRALARLQADVSDDMSLAQLVGKGVLVITI
APTEGERYQGVIALDKPTITACLEDYFVRSEQLQTQLIIRAGEFEGQPVAAGMLLQIMPD
GSGSPEDFEHLATLAATVKEEELFGLTAEELLYRLYHEERVEIFPSQPISFFCGCSQERS
GAALLLISDEELDEVLAEHNGTIDMQCECCGTHYFFNKAAIMQLKVEK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaacacagacaatgacaaactgtatcgctaccttttccaagatcgcgcggtg
cgtggtgaatgggtacggttaaaccaaacgtttactgatacgttaaatacacatcaatat
ccgaaagtcatccaaaacttgctcggtgaaatgatggtggcgaccagtttattgacggcg
acgttaaaatttgaaggggatattaccgttcaagtacaaggtgatggaccgttaaaatta
gcattagttaatggcaatcatcagcagcaaattcgcgcattagcgcgtttacaagcggat
gtcagtgatgatatgagtttggcgcaattagtcgggaaaggggtattagtgattacgatt
gcaccgacagaaggcgagcgttaccaaggcgtgattgcgttagataagccaaccattact
gcctgtcttgaagattattttgtgcgttcagaacaattgcaaacccagcttattattcgt
gctggcgaatttgaaggacaacctgtggcagccggtatgttgttacaaattatgccggac
ggttcaggttctccagaggattttgaacacttagcaacattggcagcgacggtgaaagag
gaagaactatttggtttaacagcagaagaattattgtaccgtttatatcatgaagagcgt
gttgaaattttcccttcacagccgatctcatttttctgtggctgctcacaagaacgttct
ggtgccgcattgttgttgatttctgatgaagaattggatgaagtcttggcagagcataac
ggtaccattgatatgcagtgtgaatgttgtgggacgcattatttcttcaataaagcagca
attatgcaattgaaagtagaaaaataa

DBGET integrated database retrieval system