KEGG   Pasteurella multocida subsp. multocida Pm70: PM1703
Entry
PM1703            CDS       T00046                                 

Gene name
dapF
Definition
(GenBank) DapF
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
pmu  Pasteurella multocida subsp. multocida Pm70
Pathway
pmu00300  Lysine biosynthesis
pmu01100  Metabolic pathways
pmu01110  Biosynthesis of secondary metabolites
pmu01120  Microbial metabolism in diverse environments
pmu01230  Biosynthesis of amino acids
Module
pmu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PM1703 (dapF)
Enzymes [BR:pmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     PM1703 (dapF)
SSDB
Motif
Pfam: DAP_epimerase
Other DBs
NCBI-ProteinID: AAK03787
UniProt: P57962
LinkDB
Position
complement(1909688..1910512)
AA seq 274 aa
MQFSKMHGLGNDFVVVDAITQNLYFSPETIKRLADRHRGIGFDQMLIVEPPYDPDLDFHY
RIFNADGSEVSQCGNGARCFARFVTLKGLTDKKDIAVSTQTGKMILSIKDDGMIRINMGE
PIWEPAKIPFTANKFEKNYILRTSIQTVLCGAVSMGNPHCVVQVDDIQTANVEQLGPLLE
NHERFPERVNAGFMQVIHRGHIKLRVYERGAGETQACGSGACAAVAVGVMQGLLDSKVQV
DLPGGSLIIEWEGVGKPLFMTGDATHVYDGVIRL
NT seq 825 nt   +upstreamnt  +downstreamnt
atgcaattttccaaaatgcacggcttaggtaatgattttgtagtagtggatgccattaca
caaaacctctatttttctccagaaaccattaagcgtttggcagaccgccatcgtggtatt
ggttttgaccaaatgttgatcgttgaaccaccatatgatcctgatctcgattttcattat
cgtatttttaatgcagatggcagtgaagtatcgcaatgcggtaatggcgcacgttgtttt
gcccgttttgtgacgttgaaagggttgaccgataaaaaagacattgcggtcagtacgcaa
acaggcaaaatgattttatcaattaaagatgacggcatgatccgcattaatatgggagag
ccgatttgggaacctgcgaaaatcccctttactgccaataaatttgaaaaaaactatatc
ttacgtacctctattcagacggtgttatgtggtgccgtgtcgatgggcaatccccattgt
gtagtgcaagtggacgatattcaaactgccaatgttgagcaattaggacctttattggaa
aaccacgaacgttttccagagcgcgtaaacgctggttttatgcaagtgattcatcgagga
catattaaattacgtgtgtacgagcgaggcgctggtgaaacccaagcttgcggtagtggc
gcctgtgctgcggtggcagtgggtgtgatgcaaggattattggacagtaaagtgcaagtg
gatcttccaggtgggagcttgattattgagtgggaaggcgtaggtaaaccattatttatg
acaggtgatgcgacacacgtgtatgatggagtgattcggttatag

DBGET integrated database retrieval system