KEGG   Podarcis muralis (common wall lizard): 114581554
Entry
114581554         CDS       T06059                                 

Gene name
STAT3
Definition
(RefSeq) LOW QUALITY PROTEIN: signal transducer and activator of transcription 3
  KO
K04692  signal transducer and activator of transcription 3
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04068  FoxO signaling pathway
pmua04217  Necroptosis
pmua04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114581554 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    114581554 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114581554 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmua03000]
    114581554 (STAT3)
Transcription factors [BR:pmua03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    114581554 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Baculo_PEP_C Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 114581554
NCBI-ProteinID: XP_028557630
LinkDB
Position
13
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEENRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKTLVDDEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPLLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGEVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEVTDPGAAPYLKTKFICVTPTTCSS
TIELPMSPRTLESLIHFGSNGEGAEGNASGQFESLQVFDMEMAAESANSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcacagtggaaccagctgcagcagctggacacccggtatttggagcagctccaccag
ctctacagcgacagctttccgatggagctgcggcagttccttgcgccctggatagagagc
caggactgggcctatgctgccagcaaggagtcccacgccacgttggtgttccacaacctc
ctgggtgaaattgaccagcagtacagccgcttcttacaggaatccaatgtcctctaccag
cacaacctgcgccggatcaagcagttcctgcagagcaggtatctggagaagcccatggag
attgcccgcattgtggcccgctgcctctgggaggagaacaggctgttgcagacagcagcc
acagcagcccagcaaggtgggcaggcaaaccaccctacggctgctgtggtgacggagaag
cagcagatgctggagcaacacttgcaagatgtcaggaaaagggtgcaggacttggagcaa
aagatgaaagtggtggaaaacctccaggatgactttgacttcaactacaagaccttgaag
agtcaaggcgacatgcaggacctgaacgggaacaaccagtcggtgacgcggcagaagatg
cagcagctggagcagatgctgacagccctggatcagatgcggagggggattgtgagcgag
ctggctgggctcttgtcggccatggagtacgtgcagaagacgctggttgacgacgagttg
gctgactggaagaggaggcagcagatcgcatgcatcggtggcccacccaacatctgcctt
gaccgcctagagaactggatcacgtcccttgccgagtcgcagcttcagacccgccagcag
atcaagaagctcgaggagctccagcagaaggtctcctacaagggcgaccccatcgttcag
caccggcccttgctggaggagcgcatcgtggagctattcaggaacctcatgaagagtgca
tttgtggtggagcgacagccctgtatgccaatgcacccggatcgcccactggttatcaaa
actggagtacagttcacgacaaaagtgcggttactggttaaatttcctgagctgaactac
cagctgaaaatcaaagtttgcattgacaaggattccggtgaagttgctgccctccggggg
tcccggaagtttaacatcctgggcacaaacaccaaagtgatgaatatggaggagtccaac
aatgggagcctttctgcagagttcaagcacttgacactgcgggaacagaggtgtggtaat
ggcggaagagcaaactgcgacgcctccctcatcgtcacggaagagctccatctcatcacc
tttgagacagaagtttaccaccaaggcctgaagattgacttagagacccattccctccct
gtggtggtgatctccaacatttgccagatgcccaacgcctgggcgtccatcttgtggtac
aacatgctgacaaacaaccccaagaacgtcaacttcttcaccaaaccacccattggcact
tgggaccaggtggccgaagtgctcagctggcagttctcctccaccaccaagcgaggcctc
agcatagagcagctgacaactctggcagagaaactgcttggccctggcgtcaattactcc
ggatgtcagataacatgggcaaagttctgcaaggagaacatggcaggcaaaggattctct
ttctgggtctggctggacaacatcatcgacctggtgaagaagtacatcttggccctgtgg
aacgaagggtacatcatgggattcatcagcaaggagcgggagagagcgatcctgagcaca
aagccccccggcaccttcctgttgcgattcagtgagagcagcaaggagggtgggatcacc
ttcacctgggtggagaaggacatcagcgggaagacacaaatccagtcggtggagccgtac
accaagcaacagctcaacagcatgtcgtttgctgagattatcatgggctataagatcatg
gatgccaccaacatcctggtctccccccttgtctacttgtatcctgatatccccaaggag
gaggcttttggaaaatactgccgccctgagagccaggagcatcccgaagtcactgaccca
ggtgctgctccatatctgaagaccaagttcatctgtgtgaccccaaccacttgcagtagt
actattgaactgcctatgtcaccccgcaccctcgaatctctgatccattttggcagtaat
ggtgagggagcagaggggaacgccagtggccagtttgagtccttgcaagtcttcgacatg
gagatggccgctgagagcgccaactctcccatgtga

DBGET integrated database retrieval system