KEGG   Podarcis muralis (common wall lizard): 114581697
Entry
114581697         CDS       T06059                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114581697 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmua04052]
    114581697 (EPO)
Cytokines and growth factors [BR:pmua04052]
 Cytokines
  CSF and other factors
   114581697 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 114581697
NCBI-ProteinID: XP_028557970
LinkDB
Position
13
AA seq 251 aa
MGIPGLTPLLLMLGFLAPVLLTTPEPMCDQRVMNKYIQDVSKAESEIVELCRTSCNLPEP
VMVLDTGVNIRSWRKMNRTRQASEVWRGQTLLSRAISQVQRHHSAMQPFVRQLEVMESCL
RSIRNILRGHGAQVRAKHQICGEGVLVGEEAGAHCSESQNWKGTLNGHLVQPALLLASRQ
ITALLLNSRWLLGREKRLCTCAQQRFVITETSREHAHWHFAHAQRKSSTPAGQYVQRERE
AVSSERMDEAQ
NT seq 756 nt   +upstreamnt  +downstreamnt
atggggatacctgggctgactcctctcctgttaatgttgggattcctggccccagtgctc
cttacgacccccgagcccatgtgcgaccagcgtgtcatgaacaagtacatccaagatgtc
agcaaggctgagagtgaaatcgtagaactttgtagaacttcctgcaacctgcctgaacct
gtcatggtgctggacaccggagtcaacatacgtagctggagaaaaatgaataggacgagg
caggcgtccgaggtgtggagaggccagaccctcctttcgagggccatcagccaagtccaa
aggcaccattcggccatgcagccttttgtccgccagctggaagtgatggagagctgcctg
cggagcatcagaaacatcttgcgcggccacggagcccaggtgagagcgaagcaccagatt
tgtggggagggagtgctggttggcgaggaggctggagctcattgctcagaatcacagaat
tggaaagggaccctcaatggtcatctagtccaacctgctctattgctggcatcacgacaa
atcacggccctgctccttaactccaggtggcttttaggacgagagaaacgcctttgcaca
tgtgctcagcagcgctttgttataacggagacgtctcgggaacatgcacattggcacttt
gcacatgcacagaggaagtcttccactcctgctggccagtatgtgcagagagagagagaa
gcagtttcctcggagcgcatggacgaagcgcagtag

DBGET integrated database retrieval system