KEGG   Podarcis muralis (common wall lizard): 114585406Help
Entry
114585406         CDS       T06059                                 

Gene name
GALNT17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00512  Mucin type O-glycan biosynthesis
pmua00514  Other types of O-glycan biosynthesis
pmua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    114585406 (GALNT17)
   00514 Other types of O-glycan biosynthesis
    114585406 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pmua01003]
    114585406 (GALNT17)
Enzymes [BR:pmua01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     114585406 (GALNT17)
Glycosyltransferases [BR:pmua01003]
 O-Glycan biosynthesis
  Mucin-type
   114585406 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 114585406
NCBI-ProteinID: XP_028563872
LinkDB All DBs
Position
15
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIVVKSGDSFHEIHPRAEVSNLTAHAGNPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPEEEEKAKGPHEKYGY
NSYLSEKISLDRTIPDYRPTKCKELKYPKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKVALGQ
ITGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKVKDVCLD
QGPQENHTAILYPCHGWGPQLARYTKEGYLHLGALGTTTLLPDTRCLVDNMKNRFPQLLD
CEKVKSSLHKRWSFIQNGAILNKGTGRCLEVENKGMSGMDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctgaggagagtgaaagtcctgctggtcttaaacttgattgcagttgctggg
ttcgtcctcttcctggccaagtgcaggcccatcgtcgtgaagagtggggactccttccac
gaaatccaccccagggcagaagtgtccaacttgactgcccatgctggaaaccccattcag
gatgcagttttgaaaaggctgtcacttctcgaagacattgtctacagacagctcaatggt
ctgtccaaatcactggggctcattgaaggctatggtggccgtgggaaaggagggcttcct
gccacgctttcccctgaggaggaagagaaagccaagggaccacatgagaaatatggctac
aattcctacctcagtgagaaaatatcactggaccgtaccataccagattatcgaccaacc
aagtgtaaagagctgaaatacccaaaggatctcccgcagatttctattatttttatcttc
gtgaacgaggccttgtcggtcatcctgcgttcagtgcacagtgcggtgaatcacacacct
gctcacctgctgaaggagataattcttgtagatgacaacagtgacgaagaggaattgaag
gcacccctggaagagtatgtcaacaagcgataccctggcctggtgaaggtggtccgcaat
cagaaaagggaaggcctcatccgagctcgcatcgaaggctggaaggttgccttgggccag
atcactggcttcttcgacgcacacgtggagttcacagcaggctgggctgagcctgttctt
tcacggatccaggaaaacaggaaaagagtcattcttccttctattgacaatatcaagcag
gacacctttgaggttcagcgctatgaaaattcagcccatggatacagttgggaactgtgg
tgcatgtacattagcccaccgaaggactggtgggatgctggagacccttcactaccaatc
aggactccagctatgataggctgttcttttgtggtgaaccggaagttctttggagaaatt
ggacttcttgatccaggaatggatgtttatggtggagagaacatagagcttggaattaag
gtatggctctgcggtggcagcatggaagtcctgccctgctctcgagtggcccatattgag
cgcaagaagaaaccttacaacaataacattggcttttacacaaagaggaacgcattgcgg
gtggccgaggtgtggatggatgactacaagtcccatgtgtacattgcgtggaacctgcca
ctggagaatcctggaattgatatcggagatgtttcagagcgaaaagcactcagaaaaagc
ttgaagtgcaagaacttccaatggtacttagaccacgtctacccagaaatgagaagatac
aataacaccatcgcatatggagagctgcgcaacaacaaggtgaaagatgtctgtcttgat
caaggaccacaggagaaccacacagccatcctgtatccgtgccatggttgggggccacag
cttgcccgctacaccaaagaagggtatcttcacttgggtgctcttgggaccacgacactc
ctgcctgatacccgctgcttggtggataatatgaaaaaccgattcccacaactcctggac
tgtgaaaaggtcaagagcagtctccataagcgctggagtttcatacagaacggtgcaatt
ctaaacaaagggacaggccgctgtttggaagttgagaataaaggcatgtcaggtatggat
cttattcttcgaagctgcacaggacaaaggtggacaattaagaatttcatcaagtag

DBGET integrated database retrieval system