KEGG   Podarcis muralis (common wall lizard): 114585452
Entry
114585452         CDS       T06059                                 

Definition
(RefSeq) prostaglandin D2 receptor-like
  KO
K04332  prostaglandin D2 receptor
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114585452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pmua04030]
    114585452
G protein-coupled receptors [BR:pmua04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    114585452
SSDB
Motif
Pfam: 7tm_1 CT_C_D
Other DBs
NCBI-GeneID: 114585452
NCBI-ProteinID: XP_028563962
LinkDB
Position
1
AA seq 464 aa
MIEVEATAAIPSRLPVGTNGPFSALPARPALPSLSPRPVCGRPSTLLPTLPAPRPFIGTA
RPAAPPHTRPALPAPSRRTLSPAAGSMDGGGAYRCRANRHLEGGQSALPGSLLFAAGLLG
NVLALGILWQHQLRARLQRAGGWGRPRASAFYLLVSALAATDLLGKCLLSPIVLAAYARN
RSLSELWPPPATAVGEDAAAGAGDASPGSLCQLFAFLMAFFGLAPTMLLLAMALECCLSL
GHPYFYQRHTSRRLGALLTIAAGALCALFCALPLLGFGAIVQYCPGTWCFIRMAGGGRAY
SVLYASLLGALGLAIGLCNLGSMRSLYRMARRQPPRRSQPAGAHGSGGGPGAPSTAPPGA
GRTEELGQLVLLALMTALFTICSLPMIVRAYVGAFAPDFDEKADLTALRFFSVNSIVDPW
VFIIFRTSLFRSCLRRFSRRLSSKRSTDSQLLETWERKGSDRLQ
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgatcgaggtggaggcaacagccgcgattccttcccggctccccgtgggaacaaacggc
cccttctccgccctcccggcgaggccagcgcttccttctcttagcccccgccccgtctgc
gggaggccgtccaccctcctgcccaccctccccgccccgcgccccttcataggcacggct
cgccccgccgcgccgccccacacgcgtcccgccctgcccgccccgtcgaggcgcacgctc
tcgcccgccgccggctccatggacggcggcggcgcttaccgctgccgcgccaaccggcac
ctggagggcggccagtcggcgctgccgggctcgctgctcttcgcggccggcctgctgggc
aacgtgctggcgctggggatcctgtggcagcaccagctccgcgcgcggctgcagcgcgcc
ggcggctgggggcgcccaagggcgtccgccttctacctcctggtcagcgccttggccgcc
accgacctgctgggcaagtgcctgctcagccccatcgtcctggccgcctatgcgcgcaac
cgcagcctcagcgagctctggccgccgccagcaactgccgtcggggaagacgcagccgcc
ggcgctggagacgcgagccccgggagcctgtgccagctgttcgccttcctgatggctttc
ttcggcctggcgcccaccatgctgctactagccatggccctggagtgctgcctgtcgctg
ggacacccctacttttaccagcgccacaccagccggcgcctgggcgcgctgctaaccatc
gcggcgggcgcgctgtgcgccctcttctgcgccctgccgctgctgggcttcggtgccatc
gtgcaatactgcccgggcacctggtgtttcatccgcatggccggcggcgggcgggcctac
tcggtgctctacgccagcctcctgggcgcgctgggactcgccatcggactctgcaacctg
ggcagcatgcgcagcctctaccgcatggcgcgccggcagcccccgcgaaggagccagccg
gccggagcgcacggaagcggcggtggccccggcgccccgtcgacagcgcctcccggcgcc
ggccgcaccgaggagctgggccagctggtcttgctggcactcatgaccgccctcttcacc
atctgctccctgcccatgatcgtccgtgcttacgtcggcgcctttgccccggatttcgac
gagaaggcggacctcacggccctgcgcttcttctccgtgaactccatcgtggacccctgg
gtcttcattattttccggacgtccctcttccgcagttgcctccgccggttttcgaggagg
ctgagctcgaaaaggtccacagactctcagctgctagaaacttgggagcggaaaggatcc
gatcgtctgcagtga

DBGET integrated database retrieval system