KEGG   Podarcis muralis (common wall lizard): 114585803
Entry
114585803         CDS       T06059                                 

Gene name
NOS2
Definition
(RefSeq) LOW QUALITY PROTEIN: nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00220  Arginine biosynthesis
pmua00330  Arginine and proline metabolism
pmua01100  Metabolic pathways
pmua04020  Calcium signaling pathway
pmua04146  Peroxisome
pmua04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    114585803 (NOS2)
   00330 Arginine and proline metabolism
    114585803 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    114585803 (NOS2)
   04020 Calcium signaling pathway
    114585803 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    114585803 (NOS2)
Enzymes [BR:pmua01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     114585803 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 114585803
NCBI-ProteinID: XP_028564515
LinkDB
Position
15
AA seq 1160 aa
MQRMMGPFLFKPQTSKIESQEGKDIKNNNSSSSMEKATGNFHSLAKREVASLNGLSKKPD
VITVAAREKHSPNGTKQTSRCPRHLNIKNWETGSSLQDALHYQAKEVLHCRTKVCQGSVM
NPKGLVRGPRNGLTPRDELLPQAIEFINLFYKSFKEPRIEEHLTRLETVAQEIETTGTYQ
MTGEELIFATKQAWRNAPRCIGRIQWSNLKVFDARSCATAKEMFQHICRHLEYSTNGGNI
RSAITVFPQRTDGTHDFRIWNSQLIRYAGYPMPDGSIVGDPANVEFTQLCIQLGWKPKYG
RFDVVPLILQADGQDPELFELPPELVLEVSMEHPTYEWFKELDLKWYAVPAVSNMLLECG
GLEFTACPFNGWYMGTEIGVRDFCDAQRYNILQDVGRRMGLETNKLSSLWKDKAVIEVNV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRIRGGCPADWVWLVPPISGSITPVFHQEM
LNYILSPFYYYQVEAWKTHIWKDEGRKPRKREIRFRIWAKAVLFASSLMRRATADRIKAT
VLYATETGRSETLARNLGDLFNCAFNTRVICMDDYDPKDLEKEALLLVVTSTFGNGDAPS
NGKTLQNTLLSMKQLSNRFRYAVFGLGSSMYPEFCAFARTVYQKLRQLGASPLTPMGEGD
ELNGQEEAFRMWALNTFKIACKIFAIREKHKILVPKAYTCNSTWDPENFRTVYDSQLLDL
GKALGDVHGKNIIPMKLKFRQNLQSSKSSRATILIKLSCERNQEVEYLPGDHLGIVPGNC
KVLVDGIIARITDAPPPDEIIRLERRSDRGYWTADSKFPACTLSQALTHFLDITTPPSQQ
LLRILSQLAKEESEKERLDHLSHNLEEYNKWKFYNGPTFLEVLQEFPSAEVSTSFLLSQL
PLLKPRYYSISSSQDQEPGELHLTVAVVTYRTRDGEGPVHHGVCSTWLNTVDLEETIPCF
VRSADGFRLPKDPHEPCILIGPGTGIAPFRSFWQQRLYDLEKKGIKGRSMILLFGCRHAS
LDHLYKDEMEEMKRKGILQEVYTAYSREPGYPKVYVQDLLRKKLESDVCRLLHREAGHLY
VCGDVRMARDIAKTLRDIFARNLGLTEQQAEDYCFQLKRQKRYHEDIFGAVFPHENQREL
EEMKLDRDISNWRPQPQLKF
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgcaaaggatgatgggccccttcctttttaagcctcaaaccagtaagattgagtcccaa
gaagggaaggatatcaaaaacaacaacagtagcagcagcatggaaaaagcaactgggaac
tttcacagcctggcaaaacgagaagtcgcctcgttaaatggtctaagcaagaaacctgac
gtgatcactgtagcggcaagagagaaacattccccaaatggtaccaagcaaacatcccgg
tgcccgaggcatttaaacatcaaaaactgggaaactgggagcagcctgcaagacgcattg
cactaccaggccaaagaggttcttcactgcaggaccaaggtgtgccagggatctgtcatg
aaccccaaaggtttggtcagaggtccccgcaacgggctcaccccgagagatgaattatta
cctcaagcaatagagttcatcaacctgttttacaaatcctttaaagagcccagaatagaa
gagcacctcacgcgccttgaaactgtggcccaagagatagaaacaacaggaacctaccag
atgactggggaagagctcatctttgccaccaagcaggcctggagaaatgctcccaggtgc
attgggagaatccagtggtccaatttaaaggtctttgatgcccgcagctgtgcaactgcc
aaggagatgtttcagcacatctgccgccatttggagtattccaccaacggagggaatata
agatctgccatcactgtctttccccagaggacggatgggacgcatgacttccggatatgg
aacagccaactcatccgatacgctgggtacccaatgccagatggctccattgtgggcgac
ccagccaatgtggagttcacacagctgtgcatccagcttggttggaagcccaagtatggc
cgctttgatgtggttccactgatcctccaagccgatggccaagacccggaactgtttgag
ctgccgccagagcttgtccttgaagtgtctatggaacatcccacatacgaatggtttaaa
gaactggacctgaaatggtacgccgttcctgctgtctcaaacatgctccttgagtgtgga
ggactggagttcacagcttgccctttcaatggttggtacatggggaccgagatcggggta
cgagacttctgcgatgcacagcgctacaatatccttcaggatgtagggaggcggatgggc
ctggaaacaaacaagctctcttccctgtggaaagacaaagctgtgatagaagtaaatgtg
gccgtgctgcatagctttcagaaacaaaatgtcaccatcatggaccaccattctgctgcc
gagtcgttcatgaaatacatgcagaacgagtaccggattcgaggagggtgcccagctgac
tgggtttggctggtgcctcccatctcaggcagcattacacctgtgttccaccaggagatg
ctgaactacatcctctcccctttctattattaccaggtagaagcatggaaaacgcacatc
tggaaagacgaagggcgcaagccacggaaaagagagataagattccgcatctgggccaag
gctgtgctttttgcatcgtcgctcatgcggagagccacagcggacaggatcaaagcgact
gtcctgtacgcgacggaaacaggaagatcagaaaccctggcgcggaaccttggtgacctc
ttcaactgtgctttcaacacccgggttatctgcatggatgactacgatccaaaggatctg
gagaaggaagccctcctcctggttgtcaccagcacttttggaaatggagacgcacccagc
aacggaaaaacgctgcagaacacgctgctgtctatgaaacaactgagcaacagattcaga
tacgccgtctttggcttgggttcaagcatgtatccagagttctgtgcctttgcccgcacc
gtttaccaaaagctccggcagctgggggcatcgcctctcaccccgatgggcgaaggagac
gagctcaacggacaggaagaagctttccggatgtgggcactcaataccttcaagattgcc
tgcaaaatttttgctatccgtgaaaagcacaagatcttggttccgaaagcatatacatgt
aattcaacctgggatccagagaattttaggactgtgtatgactctcagcttctggacttg
gggaaagcacttggtgacgtccatgggaagaatatcattccaatgaaactaaagtttcgg
cagaacctgcaaagttcaaaatccagtcgagcgactatcttaattaagctttcctgtgag
agaaatcaggaagtcgagtatctccctggagatcatcttgggatcgtccctggcaactgc
aaagttctcgtggatggcatcatcgcccgaatcacagatgctcctccgccggatgagatc
attaggctggaaaggcgcagcgatcgtggctactggacggcggacagcaagttcccagcc
tgcaccctctcccaagccttgactcatttcctggatattacgactccgccttcccaacag
ttgcttcggatcctttctcagctggcaaaagaagagagcgagaaggagaggctggaccac
ttatctcataacttggaggagtacaacaagtggaagttttacaacggccccaccttcctg
gaggtgttgcaggagtttccgtcggccgaggtctcaacctctttcttgctgtcgcagttg
cctttgctgaaacccaggtattactccatcagttcctcgcaggaccaagagcccggagaa
ctccacctgacggtcgccgtggtcacctacaggaccagagacggagaaggtccagtccat
cacggagtctgcagcacttggctgaacacagtcgacctagaggagaccatcccctgtttt
gtacgcagtgctgatggcttccggcttccaaaagacccacacgaaccgtgcatcctgatt
gggccaggcacaggaatcgccccattcagaagcttctggcaacagcgcctctatgatttg
gaaaagaaagggatcaaagggaggagtatgatcctgttattcggctgccgacacgccagc
ctggatcacctctacaaagacgaaatggaagaaatgaaaaggaaagggatccttcaagag
gtctacacagcatactccagagagcctggttatcccaaagtttacgtccaagaccttctt
cggaaaaagctggagtccgacgtgtgcaggctcttgcacagagaggcgggccatctctac
gtctgtggggacgtccgtatggccagagacatcgctaagacgttaagggatatatttgcc
aggaatctgggcctgacggagcagcaggccgaagattactgctttcagctgaagaggcag
aaacgataccacgaggacatatttggggctgtgtttccccacgagaaccaaagagaactg
gaagaaatgaaacttgacagagacatcagcaactggagacctcaacctcaactgaaattt
tag

DBGET integrated database retrieval system