KEGG   Podarcis muralis (common wall lizard): 114585959
Entry
114585959         CDS       T06059                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04115  p53 signaling pathway
pmua04210  Apoptosis
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114585959
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114585959
   04115 p53 signaling pathway
    114585959
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114585959
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114585959
Enzymes [BR:pmua01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     114585959
Peptidases and inhibitors [BR:pmua01002]
 Cysteine peptidases
  Family C14: caspase family
   114585959
SSDB
Motif
Pfam: Peptidase_C14 Sec16_N
Other DBs
NCBI-GeneID: 114585959
NCBI-ProteinID: XP_028564712
LinkDB
Position
15
AA seq 260 aa
MASQTKSRALIIVNYNFHGRNVESTLTERPGARKEADRIFIALSKCHYAVKFHFDLTAKE
IEELYEEECHADHGEFFVSILSSHGEEGIIYDCEGQPVHLKRIFQILEPERCHKLAGKPK
IFFIQACRGVEIDQGVWLQTDSGEAQTECFSHYLSVPQDMAVMYSCCPGYASFINRWESM
FLKALLDLLEGEECHLEVARLMTRISRTVALQEAKGKYRGGKEMPCFVTKMVREVYPFSQ
GRQASGDLSSSTRECSSNKV
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcgagccaaacgaagagcagggctctgatcattgtcaattacaatttccacggaaga
aatgtggaaagcacactcaccgaaagaccgggagccaggaaggaagcagacaggattttc
atagcattatccaagtgccattatgccgtgaaatttcactttgacttgacagctaaagaa
atagaagaactttatgaggaagaatgtcacgcagatcacggggagttttttgtaagcatt
ctgtccagtcacggagaagaagggattatctatgactgcgaaggacagccagttcatctc
aagcgtattttccagatattagaacctgaaaggtgtcacaaactggctgggaaacccaaa
atcttcttcattcaggcctgccgtggagtggaaattgatcaaggtgtttggctgcagaca
gacagcggtgaagcacagactgagtgtttctcgcactatctctccgttcctcaagacatg
gcagtgatgtattcttgctgtccaggctacgcttcgttcatcaatcggtgggaatccatg
ttcctcaaggccttgctggacctgctagaaggagaggaatgccatcttgaagttgcccgt
ttgatgacccgaattagcaggacagtcgccttgcaggaagcgaaagggaaatacagagga
ggtaaagaaatgccctgctttgtcaccaagatggtgagagaggtttaccccttctcacaa
ggaagacaggcctcaggtgatctctccagttccaccagggagtgtagcagcaacaaagtg
taa

KEGG   Podarcis muralis (common wall lizard): 114604250
Entry
114604250         CDS       T06059                                 

Gene name
CASP3
Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04115  p53 signaling pathway
pmua04210  Apoptosis
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114604250 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114604250 (CASP3)
   04115 p53 signaling pathway
    114604250 (CASP3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114604250 (CASP3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114604250 (CASP3)
Enzymes [BR:pmua01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     114604250 (CASP3)
Peptidases and inhibitors [BR:pmua01002]
 Cysteine peptidases
  Family C14: caspase family
   114604250 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 114604250
NCBI-ProteinID: XP_028600039
LinkDB
Position
9
AA seq 282 aa
MADINHIMKSSQTVTDAKKIPGSEGKSIPISKSVDSVIPADESYRMDHPEMGMCLLVNNK
NFHPATGMAYRSGTDADAAHVVDTFRTLGYTVKPYNDLTCKQIIEVLHNAAKDDHNKRSS
FVCVLLSHGEDGLIYGTDGPLELKMLTSLFRGDRCKSLAGKPKLFFIQACRGTDLDSGIE
TDSGTDESTCQKIPVEADFLYAYSTAPGYYSWRNSSDGSWFIQSLCGMLKQHATKLELMQ
ILTRVNRKVAEFSSYSNRPDFHGKKQIPCIVSMLTKDFYFPH
NT seq 849 nt   +upstreamnt  +downstreamnt
atggcagacataaaccatattatgaaatcctcacaaactgtgacagatgcaaaaaaaatc
cctggttctgaagggaagagcatacctattagcaaatctgtggactctgtgataccggca
gatgagagttacagaatggatcaccctgaaatgggaatgtgtcttttagtcaacaataaa
aacttccatccagctactgggatggcatatcgatctggtacagatgcagatgctgcacat
gttgtagacacgttcaggaccttggggtacacagtcaagccttataatgatcttacatgt
aagcagattattgaagttttgcataatgctgccaaggatgatcacaacaagagaagcagt
tttgtttgtgtcttattaagccatggagaggatggactcatctatggtacagatggtcct
ctggagctaaaaatgttaacaagtctcttcagaggagacagatgcaagtccttggcagga
aagccaaagctcttctttattcaggcttgtagaggaacagaccttgattctggtattgaa
acagacagtggcacggatgaaagcacatgtcagaaaatacctgtagaagccgacttccta
tatgcctattcaactgctcctggctactactcttggaggaactcatcagatggctcctgg
tttatacagtcactgtgcgggatgctgaaacagcatgctacaaaacttgaacttatgcag
attctgacacgtgtaaatcgcaaggttgcagaattcagttcttattcaaacagaccagac
ttccacggaaagaagcagatcccttgtattgtgtctatgctcacaaaagatttttatttt
cctcactag

DBGET integrated database retrieval system