KEGG   Podarcis muralis (common wall lizard): 114586776
Entry
114586776         CDS       T06059                                 

Definition
(RefSeq) toll-like receptor 2
  KO
K10159  toll-like receptor 2
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04145  Phagosome
pmua04620  Toll-like receptor signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    114586776
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114586776
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114586776
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114586776
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmua04131]
    114586776
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmua04147]
    114586776
   04054 Pattern recognition receptors [BR:pmua04054]
    114586776
   04090 CD molecules [BR:pmua04090]
    114586776
   00536 Glycosaminoglycan binding proteins [BR:pmua00536]
    114586776
Membrane trafficking [BR:pmua04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    114586776
Exosome [BR:pmua04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   114586776
Pattern recognition receptors [BR:pmua04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   114586776
CD molecules [BR:pmua04090]
 Proteins
  114586776
Glycosaminoglycan binding proteins [BR:pmua00536]
 Hyaluronan
  Cell surface receptors
   114586776
SSDB
Motif
Pfam: LRR_8 LRR_4 TIR TIR_2 LRR_6 LRR_9 LRR_5 DUF1863
Other DBs
NCBI-GeneID: 114586776
NCBI-ProteinID: XP_028566410
LinkDB
Position
16
AA seq 830 aa
MELPPIAVLALHLVILALAKSPEASLCQISLKAATCRGQNLLQVPGDLPATLELLDLSYN
KIQQVTHGDFSAMTKLKSLNLDFNNIVSIADDSFASNVLLEQLRLFNNSLREIPSQALKP
LRNLKVLEMSNNFYPRSTLDGVFGTLKNLETLSMGGPAVHIVGSQDFLPLEDTPLKKFAL
KTAASLQEYQEGAFSKLNTTDLWCDMSLDGHTEVLPLLLRDLRGRPLRYLHFRNLFEFTY
YIGSTDLFHDLAGVEATELVFRRGKFNENLLRLILLNVRRSRVQDLSFIAIDFARSPKWK
APEAGIANLTLRRLVLADISNPDVLRFDWTFTWFAGVTYLSIINVNFNMVPCDAWKEMRN
VVALNVSNNRLQDGYVYNEACQYQGTLPKLEQLDLSYNLLVHLSTLAKLTFSWSRLAKLD
LTHNHIGGSGRSPCTWTPSLVWLALPYNAVTTEIFQCLPTTLRFLDLSYSQLERLDMGYF
EVAVDLQELLLSGNKIKFIPTEWRCPNLRVLELDGNSFGVINKGSFVNMPRLAQLKAGNN
PYHCICDLYSFVQETLRNGKLRLLDWPAEWTCYHPEFLLDTAVAAYVPRVTECDVTVVVA
IAVSITAAVLIACMVLCWRFDVPWYLKAMFQIVRSKYRAGHSQLSRQFAYHAFISYSCSD
AEWVRRELLQRLEASCPPYRVCIHERDFTPGRWIIDNIIDNIENSRKVIFVLSRSFVDSD
WCNYELYFAHQRAVGLSFEDVVLVVKEAIDLQALPNKFCRLRKMLSTKTYLEWPSDYNRQ
AFFWVQLTSVLGKAEPVNSDPSSDPTDVNGAVDNHLDMGPIAEENCVGCG
NT seq 2493 nt   +upstreamnt  +downstreamnt
atggaactgccgcccatcgccgtcctggcgttgcatttggtgatcctggctcttgcgaaa
tctcccgaggcatctctttgccagatctccctcaaggcggccacttgtcgaggccagaac
ctgctccaagtccctggagatctccccgccactctggagttattggacctatcttacaac
aagattcagcaggtcacccacggggatttctctgccatgaccaagctgaaaagcctgaat
ctggatttcaacaacattgtgtctatcgctgacgattccttcgcctccaacgtcctcttg
gagcagctcagactcttcaacaactctctgagggagatcccgtctcaggcgctgaaacca
ctgaggaatctgaaggtcttggaaatgtctaacaacttttatccccgctcgacgctggac
ggcgtgtttggcactttgaaaaacctcgaaaccctctccatggggggccctgctgtccac
attgtgggaagccaggacttccttcctctggaagacaccccgttgaaaaagtttgctctg
aaaacggcagccagtttgcaggagtatcaagagggggccttttccaaactcaacaccact
gacttgtggtgcgacatgtcgctggatggacacacagaggtcttgccgctgctgctgcgg
gacttgaggggaaggcctctgcgatacctccatttccgcaacctctttgagttcacgtac
tacataggctctacggacctcttccacgacttggctggggtggaggccacagagctggtc
ttccgccgggggaaattcaacgagaacttgctgcgtctgatcctgctgaacgtccggagg
tctcgcgtgcaagacctgtccttcatagctatcgattttgcgcggtcgcccaagtggaag
gcaccggaagctggcatagccaacctcaccctgcggcggttggttctggcggacatcagc
aacccagacgtcctgcgtttcgactggaccttcacgtggtttgcgggcgtgacgtacctc
tccatcatcaacgtcaacttcaacatggtgccttgcgacgcctggaaggagatgaggaac
gtggtggctttgaacgtctccaacaaccgcttgcaagatggctacgtctacaacgaggcc
tgccagtaccagggcactctgcccaagctggaacagcttgacctcagctacaacttacta
gtccacctgagcactcttgccaagttgaccttcagttggtcccgactcgccaaactagac
ctgacccacaatcacattgggggctcaggtcggtccccctgtacgtggactcccagtctg
gtttggctggccctgccttacaacgcagttaccacggaaatcttccagtgtctccccact
actttgcgctttctggacttatcgtattcccagctggaacggctagatatgggctacttc
gaggttgctgttgacctccaggagctactgctgagtgggaacaagatcaaattcatccct
acagagtggagatgcccaaacttgagggttctggagctggatggcaactcttttggcgtc
atcaacaaaggttcctttgtcaacatgcctcgtcttgctcaactgaaggcgggcaacaac
ccttatcactgcatctgtgatctctacagctttgttcaagagacactgaggaatgggaaa
ctcaggctgctggactggccggctgaatggacctgttaccaccctgaattcttgttggac
actgcggtggcggcttatgtcccgagggtgacagagtgtgacgtcacagtggtggtggcc
attgcagtctccatcacagctgcggtgctgattgcctgcatggttctgtgctggaggttt
gatgttccgtggtatctcaaggccatgttccagatcgtccgctccaagtaccgagccggc
cactcccagctgtcgcggcagtttgcctaccacgccttcatttcctacagctgctccgac
gccgaatgggtgaggcgagagctcctgcagaggctggaggcttcctgcccgccgtaccgc
gtctgcatccacgagcgcgacttcacgccggggcgatggatcatcgacaacatcatcgac
aacatcgagaacagccgcaaggtcatcttcgtcctctcgcgcagctttgttgacagcgac
tggtgcaattacgagctctactttgcccaccagcgggctgtgggcctgagcttcgaggac
gtcgtgctggtggtgaaggaagccattgacctgcaggcgttgcccaacaaattctgcagg
ttacggaagatgctgagcacaaagacttacctggagtggccttcagattacaaccggcag
gccttcttctgggtccagttgacatctgtgctgggtaaagccgagccagtcaactcagac
ccaagcagtgacccaactgatgtgaatggggcagttgacaatcatcttgacatgggtcct
atagctgaagaaaactgtgttggatgtggctga

KEGG   Podarcis muralis (common wall lizard): 114601154
Entry
114601154         CDS       T06059                                 

Gene name
CD14
Definition
(RefSeq) monocyte differentiation antigen CD14
  KO
K10159  toll-like receptor 2
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04145  Phagosome
pmua04620  Toll-like receptor signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    114601154 (CD14)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114601154 (CD14)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114601154 (CD14)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114601154 (CD14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmua04131]
    114601154 (CD14)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmua04147]
    114601154 (CD14)
   04054 Pattern recognition receptors [BR:pmua04054]
    114601154 (CD14)
   04090 CD molecules [BR:pmua04090]
    114601154 (CD14)
   00536 Glycosaminoglycan binding proteins [BR:pmua00536]
    114601154 (CD14)
Membrane trafficking [BR:pmua04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    114601154 (CD14)
Exosome [BR:pmua04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   114601154 (CD14)
Pattern recognition receptors [BR:pmua04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   114601154 (CD14)
CD molecules [BR:pmua04090]
 Proteins
  114601154 (CD14)
Glycosaminoglycan binding proteins [BR:pmua00536]
 Hyaluronan
  Cell surface receptors
   114601154 (CD14)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_9 FNIP
Other DBs
NCBI-GeneID: 114601154
NCBI-ProteinID: XP_028594072
LinkDB
Position
7
AA seq 481 aa
MCGKEQKEICGRSVAETSLNFQSSWVCIMLRTQAFVFSLLLGLELPKAKANCNFTESQRH
CVCSLEANNFIQCLPATTYELRGGNLEQFAGSSGIKPNPQIIEILEALLVRKLIFTDLIV
PEVLVPGSLQFLSYTQVSELEFVNCTFLRATHWSLQGWWDLKVSSLRFHKVTAAPLDDRL
NMSRLRRWLETLQNLTVTESQVTSVPCEISKMFTSLHLLDVSGNSFQDQTMKSTFCEGVF
PQLQILKLHHNNLTSFETVCKTLGHLKMLTHLDLSQNNFQPRVFSSSCRWPHSLQIFNLS
STGLEQIGSSLPPNIEILDLSANNIFTLDFSLPALKELYLSKNRLQTVPSLDRLPSLQVL
SLDQNQISQLPSNHLLRLQSLKAGHNLYNCSCSRDIQDLAAKPSLLPDWPQDYTCHSPLN
YQGSLVKNAHFSSLQCKALVTRGSIFNLLICLHLVFLFAFSATISGHFLSAILNCWESSG
S
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgtgtggaaaggagcagaaggagatctgtggcagatctgtggcagaaacgagtctcaac
ttccagagcagttgggtttgcatcatgctcagaactcaggcctttgtgttctcccttctc
ctgggactggaactccccaaagcaaaagccaactgtaactttacagagtcccaacgtcac
tgtgtttgttcactagaggcaaataacttcattcagtgccttccagccaccacatatgag
cttcgaggaggaaatctggaacaatttgcaggttcttctggaatcaagccaaacccacag
ataattgaaattctggaggccctgctagttcgcaagctcatatttacagacctcattgtg
ccagaggttcttgtgccagggtccctgcaatttctttcctacactcaggtctcagaactt
gaatttgtaaactgtactttccttagagccactcactggagcctccaaggttggtgggac
ctgaaggtttcttccttgcgctttcacaaagtgacggctgcccccctggatgacagactg
aacatgtcccgcctgagaaggtggctggagaccctgcagaatctgacagttacagagtca
caagtcacatctgtcccgtgcgaaattagcaagatgttcacatcgttgcatttactggat
gtttcgggaaacagtttccaggaccaaaccatgaagtcaacattctgcgaaggggttttt
ccgcaactccaaatcttaaaactccaccacaacaatctgacctcttttgagactgtgtgc
aagactcttggccatctcaagatgctcactcacttagacctaagtcagaataactttcag
ccccgagtcttttcctcctcctgcaggtggccacattcacttcaaatttttaatttgtcc
agtacagggttagagcaaataggcagttctctgccacccaacattgagatattagacctg
agtgccaataacatttttacccttgacttctcactccctgccttgaaagagctctacctg
tccaaaaacaggctgcaaactgttccctcacttgacaggctccctagtttgcaggtcctc
agtcttgatcaaaaccagatctcacagcttcccagcaaccatctcctgcgtctgcagagc
ttgaaagctggccacaatctctacaattgttcttgttccagggatatccaggacttagca
gcaaaaccatcattactgcctgattggcctcaggattatacatgccattcccctctcaat
taccagggctccctggtaaaaaatgcacatttttcatcactgcagtgcaaggctctggtc
actcgtggctcaatattcaacttgctgatatgccttcaccttgtttttctgtttgctttc
agtgctacaatttctggacattttctttcagcaattctgaactgttgggaatcgtcaggg
agctaa

DBGET integrated database retrieval system