KEGG   Podarcis muralis (common wall lizard): 114587106
Entry
114587106         CDS       T06059                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04137  Mitophagy - animal
pmua04210  Apoptosis
pmua04218  Cellular senescence
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04622  RIG-I-like receptor signaling pathway
pmua04623  Cytosolic DNA-sensing pathway
pmua04625  C-type lectin receptor signaling pathway
pmua04920  Adipocytokine signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114587106 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    114587106 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    114587106 (RELA)
   04218 Cellular senescence
    114587106 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114587106 (RELA)
   04621 NOD-like receptor signaling pathway
    114587106 (RELA)
   04622 RIG-I-like receptor signaling pathway
    114587106 (RELA)
   04623 Cytosolic DNA-sensing pathway
    114587106 (RELA)
   04625 C-type lectin receptor signaling pathway
    114587106 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114587106 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114587106 (RELA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114587106 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmua03000]
    114587106 (RELA)
Transcription factors [BR:pmua03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    114587106 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 114587106
NCBI-ProteinID: XP_028566864
LinkDB
Position
16
AA seq 568 aa
MGDSLPQGGFQAANMDDLLPLLLQHNWGLPDPPASSTPVVEIIEQPKQRGMRFRYQCEGR
LAGSIPGERSTDTTKTHPTIKIHNYTGPGKVRISLVTKEVPYRPHPHDLVGKDCKEGYYE
AELSPERSIHSFQNLGIQCVRKRDLDKAVAKRIETNNNPFNVSMEELKGDYDLNAVRLCF
QVWIQDAGSGRLVQLPLAISQPIYDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQ
KEDIEVRFFKDSWEAKGSFSQADVHRQVAIVFKTPPYMDQALREPVTVQMQLRRPSDKEV
SGPMEFRYLPDEGDFNRIDEKRKRTLGTFKNFVQKTPFAVGAPEPRSQRRIAVPKHGLAR
PNISGVPGIMGASGQTPLPTSKPQAMVHPSPAYFTGPSHAPLPAAAPPPTAATQSSFSTV
NMEDLSGLGVSHRVQPSESEAEASIADAFLHLHFEGADAGGMELGGILDDAPYTSLEGIN
TAEFCQLLTEGAAQQALQDNQGTLLTYPESISRLVSQRRAQGEPSGGGGGSSSGASCYNG
LPGALPAEESFSSMVDFDLNSLLNQLNS
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgggggactctctgccccaggggggcttccaggctgccaacatggacgatctcctgccg
ttgttgttgcaacataactggggtcttccagaccctcccgcaagcagcactcctgtcgtg
gagataattgaacagcccaagcagcgcggcatgcgcttccgctatcagtgcgaagggcgg
ttggctggctccattcccggggagcgcagcacagacaccaccaagacccaccccaccatc
aagatccacaactatacaggcccaggcaaggtccgcatttcgctggtcaccaaggaggtc
ccctaccggccccacccgcacgacttggtggggaaggactgcaaagaaggctattatgaa
gcagagctgtctccagagcgctccatccacagcttccagaacttgggaatccaatgcgtg
cggaaacgagacctggacaaggccgtggccaagcggatcgaaaccaacaacaacccgttc
aatgtgtccatggaagagctaaaaggagactatgacctgaatgcggttcggctctgtttc
caggtgtggattcaggatgcaggcagtgggcgcttggtccagctgcccctggcaatctca
cagcccatctatgacaatcgtgctcccaacacagccgagttgaagatctgccgtgtgaac
cgcaattcagggagctgcctgggtggagacgagatcttcctcctctgtgacaaggtccag
aaagaggacatcgaagtccgcttcttcaaggactcttgggaggcaaagggctccttctcc
caagccgacgtccatcgccaagtggccattgtcttcaagaccccgccgtacatggaccaa
gccctccgggagccggtgacagtccagatgcagctgcgtcgcccatccgacaaggaagtc
agtgggcccatggagttccgttatcttcctgatgaaggtgacttcaatcgtattgacgag
aaacgcaaacggacccttggcaccttcaagaactttgttcagaaaacaccctttgcagtc
ggagctccagaacctcgctcccagcgccgcattgctgttcccaaacatggcctggcccgg
cccaacatcagcggtgtcccaggaatcatgggagcatcagggcaaaccccactgcccacc
tccaaaccccaggccatggtgcacccttctcccgcctacttcacggggcccagccatgcc
ccacttccagcggcggctcctcctccgaccgcagctacgcagtccagcttcagcacggtg
aacatggaagatctgtcgggcctgggcgtgagccatcgggtccagccctccgagtcggag
gccgaggccagcattgcagacgccttcctgcacctccactttgaaggggcggatgctggg
ggcatggagcttgggggaatcctggatgatgccccctacaccagcctggaggggattaac
acagccgagttctgccagctcctcacagaaggggccgcccagcaagcactccaggacaac
caaggcactctgctgacctatccagagtcgatcagccgcctggtgtcccagcggagagcc
caaggggagcccagtggagggggcgggggcagcagctcaggtgccagctgctacaatggc
cttccgggggcccttcctgctgaggaaagcttttcctccatggtagattttgacttgaac
tctcttctgaaccagctgaactcataa

DBGET integrated database retrieval system