KEGG   Podarcis muralis (common wall lizard): 114587799
Entry
114587799         CDS       T06059                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A-like
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04060  Cytokine-cytokine receptor interaction
pmua04150  mTOR signaling pathway
pmua04210  Apoptosis
pmua04217  Necroptosis
pmua04920  Adipocytokine signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114587799
   04150 mTOR signaling pathway
    114587799
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114587799
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114587799
   04217 Necroptosis
    114587799
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114587799
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114587799
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114587799
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pmua04050]
    114587799
   04090 CD molecules [BR:pmua04090]
    114587799
Cytokine receptors [BR:pmua04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   114587799
CD molecules [BR:pmua04090]
 Proteins
  114587799
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 114587799
NCBI-ProteinID: XP_028568408
LinkDB
Position
17
AA seq 408 aa
MAPLGLFPVLVAVVNLNLIRTESGGSLRVTLNPVTKPIPAAVVDKDAFLHSSSKQKRELK
CSIGYYLHPNKTHCCLRCHKGTFVAQHCLDSDKATKCSVCSEGSFIDGDNSSEQCRGCRR
CRPTFGQIEVSKCTSEHDTVCGCGSDQYQSSHSDEFMCKNCSACLNGRIKLACTKFRDTI
CECRSEYFLQKDENKCYPCSSCNEKECEMDCDFFKVVKPENHPHQALLLTVIVILIVTVG
ILLLVNILRKRSCQKRFSSTFCPFASNLQPTSEPSPEVVEKGKGTFLEQNQTDNLLLLKA
TPADLPDCVRVAGETQISDRPEVLYAVVDQVPLTRWNEFVRRLGLNEISIERIYAEHRHI
REAQYVMLRQWRQQAGHGATVERICYVLNQMEMSGCSETIQEVLSNLP
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggccccgctggggctcttcccagtcttagtggccgtggtcaacttgaacctcattcgg
acagaaagtgggggatcattgcgggtaaccctgaaccctgttacgaaacctatccctgca
gcagttgtggacaaggatgccttcctgcattccagcagtaaacaaaagagggagctgaaa
tgctcaataggatactatcttcacccaaataaaacccactgctgccttagatgccacaaa
ggaactttcgttgcacaacactgtttagactctgataaggcaaccaagtgctcagtctgc
tctgagggttccttcattgatggagataatagctctgagcagtgtcgcggatgccgacgc
tgccgtccaacctttggacaaatagaggtatccaaatgtaccagtgagcacgacacagtt
tgcggttgcggcagtgatcaatatcaaagtagccacagtgatgaattcatgtgcaagaat
tgcagtgcttgtctcaatggaagaatcaagctggcttgtaccaaattcagggatacaata
tgtgagtgtcgctctgaatactttctccaaaaagatgaaaacaagtgctacccatgcagc
agctgcaatgagaaagaatgcgagatggactgcgacttttttaaagtggtaaagccagaa
aatcacccacaccaagcacttctcctcactgtaatagtcattttaatcgtaactgttggt
atattgctgttggtgaacatacttcgcaaacgatcctgtcagaagaggttcagctccact
ttctgtccatttgcttcaaatctgcagccaacaagtgaaccttccccagaggtggtagag
aaaggaaaaggcacatttctggaacaaaaccagacagacaatcttttgctactgaaagcc
acaccagctgacctcccagattgtgtaagagtggcaggagagacacaaatctcagatcgt
cctgaagttttgtacgctgtggtggatcaagtaccgctgacccggtggaacgaatttgtg
cggcgcctgggactgaatgaaatttccatagagaggatttatgcagagcatcggcacatt
cgagaagcacaatatgtcatgctgagacaatggaggcagcaagcaggccatggggccact
gtagagcgcatttgttatgttctcaaccaaatggagatgagtggctgtagtgagactatt
caggaggttctgtccaacctgccttag

KEGG   Podarcis muralis (common wall lizard): 114588143
Entry
114588143         CDS       T06059                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A-like
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04060  Cytokine-cytokine receptor interaction
pmua04150  mTOR signaling pathway
pmua04210  Apoptosis
pmua04217  Necroptosis
pmua04920  Adipocytokine signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114588143
   04150 mTOR signaling pathway
    114588143
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114588143
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114588143
   04217 Necroptosis
    114588143
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114588143
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114588143
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114588143
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pmua04050]
    114588143
   04090 CD molecules [BR:pmua04090]
    114588143
Cytokine receptors [BR:pmua04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   114588143
CD molecules [BR:pmua04090]
 Proteins
  114588143
SSDB
Motif
Pfam: TNFR_c6 Ephrin_rec_like
Other DBs
NCBI-GeneID: 114588143
NCBI-ProteinID: XP_028568932
LinkDB
Position
17
AA seq 222 aa
MALLELLPVLVAMINLNLVQTDTGEPLIPDAKPIPASVVDKDALIHSSGIQKRELECSEG
YYRHPDETHCCLKCPRGTYIAQHCLNAEETSKCSACPEGSFMPEDHFSERCLGCLQCRRT
FGQIEVSKCTSENDTVCGCGSDQYQSSRSLDFMCKSCSDCPDGRIQQPCTKFSDTVCESA
SMDFFSQKQMLPMQQSARLPDRQRHQAQKRKFFKFPYRPLSK
NT seq 669 nt   +upstreamnt  +downstreamnt
atggctctgttagagctgctcccagttttagtggcgatgatcaacttgaacctcgttcag
acagacacaggggaacccctcatccctgatgctaaacctatccctgcatcagttgtggat
aaggatgccctcatccactccagtgggatacaaaagagggagctggaatgctccgaagga
tactatcgtcacccggatgaaacccactgctgccttaaatgccccagaggaacgtacatt
gcacaacactgtttaaacgcggaggagacatctaagtgctcagcatgccctgagggttcc
ttcatgcctgaagatcatttctctgaaaggtgtctcggatgccttcagtgccgtcgaacc
tttggacaaatagaagtctccaaatgcaccagtgagaacgacacagtttgcggttgtggc
agcgatcaatatcaaagtagccgcagtcttgactttatgtgcaagagctgcagtgactgt
cccgatggaagaatccagcaaccttgtaccaaattcagtgacacagtatgtgagagtgcc
tccatggattttttctcccaaaaacaaatgctacccatgcagcagtcagccagattgcca
gacagacagcgacatcaggctcagaaacgaaaattcttcaaattcccttatcggcctctt
agtaaatag

DBGET integrated database retrieval system