KEGG   Podarcis muralis (common wall lizard): 114588195
Entry
114588195         CDS       T06059                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04210  Apoptosis
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04622  RIG-I-like receptor signaling pathway
pmua04623  Cytosolic DNA-sensing pathway
pmua04625  C-type lectin receptor signaling pathway
pmua04920  Adipocytokine signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114588195 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114588195 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114588195 (IKBKG)
   04621 NOD-like receptor signaling pathway
    114588195 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    114588195 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    114588195 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    114588195 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114588195 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114588195 (IKBKG)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114588195 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmua01001]
    114588195 (IKBKG)
Protein kinases [BR:pmua01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   114588195 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Spc7 APG6_N Jnk-SapK_ap_N Csm1_N FumaraseC_C DUF2353
Other DBs
NCBI-GeneID: 114588195
NCBI-ProteinID: XP_028569031
LinkDB
Position
17
AA seq 593 aa
MSTAQGGWSCDMVQPGGCPGNDCGMMGDDSSLGKAATIHLPAELAGHEVVQHFLAENRDL
KEAIRQSNHMLREHYKEFLQFQASHKEEKEFLMLKFQEARLVVEKLHLERTGLKKQLEQA
VQELERLKEQLTASQPFPKERETSGAQEEPDTVTLTQGEAVLALVPEMPQQTKERLEEDL
KELQEANQVLQKDKLALQAEICALQQAVKGTSPTEKPAVKMKENGVAEEQPVELESLQGS
GARNSSGQDQAEELCKRLKEVEDESSALRQQLASAREELVRLAAREHETQQQLQTLSKQL
EQAGEDKASVKAQVTSLLGELQESQSRLETCTQEKKELEERVRAAGERLQHLEKEAEART
KQHSVQVDQLRLQVQNLESALRVERQSATEEKRKLAQLQVAYHQLFQEYDSHIKASLENE
KWSQGLDVRAAELSEQLQQAEEALVAKQELIDKLKEEAEQHKAIMETVPVLKAQADIYKT
DFLAERHAREKLHEQREALLEQVAQLQRDYEKLQAESEGVRRSLMEEMRNRHSEMRPQPQ
PGFPRGPAPFHPQLLTVRRQSLAEEPIEFSCPKCQYRAPDMDTLQIHVMDCIQ
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgagtacagcccaagggggctggagttgtgacatggtacaaccaggcggatgcccgggt
aatgactgcggcatgatgggcgatgattcctctctgggcaaagctgccaccattcacctt
ccagctgagctggcaggacatgaggttgtgcagcactttctggctgagaacagagatctc
aaagaagctatccgacaaagtaaccacatgctgcgggagcactacaaggagttcctgcaa
ttccaggcttcccacaaggaggagaaggagttcctcatgctcaagttccaggaagcccga
cttgtggtggaaaagctgcacttagaacgcacagggctgaaaaagcagttggagcaggct
gtccaggaactggagcgactgaaggagcaactgacagcatctcagccatttcccaaagag
agagagacctctggagcacaagaggagccagacactgtaacccttacccaaggagaagct
gtacttgctctggtccctgagatgccacagcagacaaaggagaggctggaggaggatttg
aaggagctccaggaagccaaccaggtcttgcagaaagacaagctggcattgcaggctgag
atctgtgcactgcaacaagcagtgaagggcacctcgcccacagaaaagcctgcagtaaag
atgaaggagaatggagttgcagaagaacaacctgtggagttggaatccttgcagggctca
ggggccagaaatagttctggtcaggaccaggctgaagagctatgcaagaggctgaaggag
gtagaggatgagagttcagcccttcgtcaacagctggcatcagccagagaggagctcgtg
cgtctggcagcaagggaacatgagacccagcagcagctacaaacactgagcaagcagctg
gagcaggctggggaggacaaggcctcagtaaaggctcaggtgacttccttgttgggggag
ttgcaggagagccaaagtcgcctggaaacctgcacacaggaaaagaaagagctggaggag
agggtccgtgcagctggcgaaagactccaacatcttgaaaaggaggctgaagcccgcacc
aaacagcacagtgtgcaagtcgatcagttgcgcctgcaggtgcaaaatctagaaagtgcc
ttgcgagtggagcggcagagcgccacagaggaaaagagaaaattagctcagctgcaggtg
gcctatcaccagctcttccaggagtatgactctcatatcaaagccagtctagaaaatgag
aagtggagccagggtttggatgtgcgggctgctgaattgtctgagcaattacagcaggct
gaagaggctctggtggccaagcaggaactgattgacaagctgaaggaggaggctgagcag
cacaaggctatcatggagactgtgcctgtgctcaaggcacaggctgatatctacaagaca
gacttcttggcagagcgtcatgctcgggaaaaactacatgaacagcgagaggccctgctg
gagcaagttgcacaactgcagagagattatgaaaagctgcaagcagaatctgagggagtc
agacgttctctgatggaagagatgaggaatcgccattcagaaatgcggccacaacctcag
ccaggtttcccgaggggtcctgccccattccacccccagcttctaacagtgagaagacaa
agccttgctgaagaaccgattgagttctcttgtcccaagtgccagtacagggctccagac
atggacactctacaaatccacgtcatggactgtatccagtga

DBGET integrated database retrieval system