KEGG   Podarcis muralis (common wall lizard): 114588937
Entry
114588937         CDS       T06059                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04115  p53 signaling pathway
pmua04210  Apoptosis
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114588937
   04115 p53 signaling pathway
    114588937
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114588937
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114588937
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 114588937
NCBI-ProteinID: XP_028570582
LinkDB
Position
2
AA seq 105 aa
MGDVEKGKKIFVLKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTEANNSKGITW
GEDTLMVYLENSKKYIPGTKMIFAGIKKKGERADLISYLKEATSN
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagacgttgagaagggcaagaagatctttgttctgaagtgttcacagtgccacaca
gttgagaagggaggcaagcacaagactggccctaacctgcatggtctttttggccgaaag
actggtcaggccgaaggtttctcttacacagaagccaacaacagcaaaggtataacctgg
ggagaagatacactgatggtttacttggaaaactccaagaagtatattccaggaaccaag
atgatatttgctggcattaagaagaagggagagagggcagatttaatatcataccttaag
gaggccacttcaaactaa

KEGG   Podarcis muralis (common wall lizard): 114606416
Entry
114606416         CDS       T06059                                 

Definition
(RefSeq) cytochrome c, testis-specific
  KO
K08738  cytochrome c
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04115  p53 signaling pathway
pmua04210  Apoptosis
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114606416
   04115 p53 signaling pathway
    114606416
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114606416
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114606416
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 114606416
NCBI-ProteinID: XP_028604478
LinkDB
Position
1
AA seq 105 aa
MGDFEKGKKIFVQKCSQCHTAEKGGKHKTGPNLWGLFGRKTGQAAGFSYSEANKNKGIVW
SENTLMEYLEDPKKYIPGTKMIFAGIKKSNERADLIAYLKKATSS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgattttgaaaagggtaaaaagatctttgttcaaaaatgttctcagtgtcataca
gctgaaaaaggtggaaagcacaagactggcccaaatctttggggtctctttggccgaaaa
accggacaagctgcaggattttcttattcagaagcaaacaagaataaaggtattgtctgg
agtgaaaacacactgatggaatatttggaggatcctaagaaatacattcctggaacgaaa
atgatttttgctggcattaaaaagagtaatgaaagggcagatctcattgcatacttgaaa
aaagcaacctcttcatga

KEGG   Podarcis muralis (common wall lizard): 114607597
Entry
114607597         CDS       T06059                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04115  p53 signaling pathway
pmua04210  Apoptosis
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114607597
   04115 p53 signaling pathway
    114607597
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114607597
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114607597
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 114607597
NCBI-ProteinID: XP_028606772
LinkDB
Position
12
AA seq 105 aa
MGDVEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKSKGITW
GEDTLMVYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKEATSN
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagacgttgagaagggcaagaagatctttgttcagaagtgttcgcagtgccacaca
gttgagaagggaggcaagcacaagactggccctaaccttcatggtctttttggccgaaag
actggtcaggccgaaggtttctcttacacagacgccaacaaaagcaaaggtataacctgg
ggagaagatacactgatggtttacttggaaaaccccaagaagtatattccaggaaccaag
atgatatttgctggcattaagaagaagggggagagggcagatttaatagcatacctgaag
gaggccacttctaactaa

DBGET integrated database retrieval system