KEGG   Podarcis muralis (common wall lizard): 114589186Help
Entry
114589186         CDS       T06059                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: prostaglandin G/H synthase 1-like
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00590  Arachidonic acid metabolism
pmua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    114589186
Enzymes [BR:pmua01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     114589186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 114589186
NCBI-ProteinID: XP_028571192
LinkDB All DBs
Position
Z
AA seq 641 aa AA seqDB search
MQAEARTRRRSVPRGGDFAGLPWRPRQAGKGTAICLLDLPCLEALSSCNVLAVLRSSLGD
AAGASPGSFSTVNPCCYFPCQHKGVCVRVGTEGYECDCTRTGYFGTNCSLPEFWTRLRDA
LKPSPAFYHFILTHFQWFWTIVNNTFIRDTLMRLVLTIRANLIPSPPTYNSAHGYISWES
YANVSYFTRVLPPVPTDCPTPMGTKGPPQLPDAQLVAEEFFLRKKFHPDPQGTNLMFAFF
AQHFTHQFFKTSGKMGHGFTRALGHGVDLGHLYGDNLERQHELRLFRDGKLKYQVVKGEI
YPPTVLDAPVHMIYPKHIPAEKQLAVGQEVFGLLPGLMMYATIWLREHNRVCDLLKQIHP
TWDDEQLFQTARLILIGETIKIVIEDYVQHLSGYFLQLKFDPELLFGVQFQYRNRIAVEF
NQLYHWHPLMPDTFKIQDQEYSYNQFVYNTTMLMDYGVEALVDAFSRQQAGQIGGVPNIH
KQLLKVAIGVIEESRLLRLQSFNEYRKRFGMKPYTSFQELTGEEETAAKLEALYRDIDAL
EFYPGLLVEKSQHNSIFGESMVEIGXPFSLKGLFGNPICSPEYWKPSTFGGDAGFQLVNT
ASLQKLVCLNVKRCPYVAFRVPGGGEDAVVLAKEKGPLDEL
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagaggcaagaaccaggaggaggagcgtcccacggggcggggactttgccggg
ctgccttggaggccacggcaggcaggaaaaggcacagctatctgcctgctggatttaccg
tgcctggaggctctctcctcttgcaatgtactggctgtgctgcgctcttcccttggtgat
gctgctggggccagccctggaagtttcagcacagtgaatccatgctgctatttcccatgc
caacacaagggcgtgtgtgtccgggttggcacagagggctacgaatgcgattgcacccgg
accggctactttggcacaaactgctctctgccggagttctggacgcggttgcgcgatgcc
ctgaagccgagcccagccttctatcattttatcctgacccacttccagtggttctggaca
attgtcaacaacaccttcatccgggacactttgatgcgtttggtgctgacgatccgagcc
aatctcatccccagtccacccacgtacaattccgcccacggctacatcagctgggagtcc
tacgccaatgtcagctatttcactagggtgctcccaccggtgcccaccgactgccccacg
ccaatgggaaccaaagggccaccgcagcttcctgatgcacagctggtagctgaagagttt
ttcctgcgcaagaaattccacccggacccccaggggacaaacttgatgtttgcgttcttt
gcccaacacttcactcaccagttcttcaagacgtctgggaagatgggccatggcttcacc
agggctctaggccatggggtggatcttggacatttatatggagacaacttggaacgccaa
catgaactgaggctcttccgagacgggaagttgaaataccaggtggtgaaaggggaaatt
tatcccccgacggtactggacgcccccgtgcacatgatctacccaaagcacatccccgca
gaaaagcagctggctgtgggccaggaggtgtttgggctgctcccgggactcatgatgtac
gccaccatttggctccgcgagcacaaccgcgtctgtgaccttctcaagcagattcacccc
acctgggatgatgagcagctgttccagaccgcaaggctcattcttattggtgagaccatc
aagatcgtcattgaggactatgtccagcatctgagtggctacttcctacagctgaagttc
gacccagaactcctctttggagttcagttccagtaccggaaccgcattgcagtggaattc
aaccagctctaccactggcatccactgatgccagataccttcaagatccaggatcaagag
tacagctacaaccagtttgtctacaacaccactatgctgatggactatggagtggaggcc
cttgtagatgccttctccaggcagcaagctgggcagattggtggggtaccgaacatccac
aagcagcttcttaaagtggccattggagtcattgaggagtcaaggctgctgcgcctccag
tccttcaacgaataccggaagaggtttggcatgaagccctacacctccttccaggagctg
acaggtgaagaagaaactgctgccaaactggaggccctgtacagagacattgacgccctt
gagttctacccaggtctgctggtggagaagagccagcacaactcaattttcggcgagagc
atggtggagatcgggnccccattctccttgaagggtctttttgggaaccccatttgctcc
ccagagtactggaagcctagcacctttggtggtgatgctggcttccagctggtgaacaca
gcctcactccagaaactggtgtgcctcaatgtcaagaggtgtccctatgtggccttccgg
gttcccggcggtggagaggatgccgttgtgcttgcaaaggagaaggggccattggatgag
ctctag

DBGET integrated database retrieval system