KEGG   Podarcis muralis (common wall lizard): 114591226
Entry
114591226         CDS       T06059                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114591226 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114591226 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmua04052]
    114591226 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pmua00536]
    114591226 (FGF1)
Cytokines and growth factors [BR:pmua04052]
 Growth factors
  Growth factors (RTK binding)
   114591226 (FGF1)
Glycosaminoglycan binding proteins [BR:pmua00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   114591226 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 114591226
NCBI-ProteinID: XP_028573772
LinkDB
Position
2
AA seq 155 aa
MAEGEITTFTALTEKFDLPMGNYKKPKLLYCSNGGHFLRILPDGKVDGTMDRNDQHIQLL
LSAENLGEVYIKSTESGHYLAMDANGRLYGSQLPTEECLFLERMEENHYNTYTSKMHADK
NWFVGLKKNGKSKLGPRTHYGQKAILFLPLPVSPD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacgacattcacagctctgacagagaagtttgatctcccgatg
gggaattacaagaagcccaaactcctttactgcagcaacggaggccatttcttgaggata
cttcctgatggcaaagtagatggcacaatggatcgaaatgaccaacacattcaactgctg
ctaagtgcggaaaatttgggtgaggtgtacataaagagcacagagtctgggcactacttg
gccatggatgccaatggccgtttatatggctcgcagttgccaacggaagagtgtttgttc
ctggagagaatggaagaaaaccattacaatacctacacatcaaagatgcacgcagataaa
aactggtttgtcggcttgaagaagaatgggaaaagcaaactgggaccgcggactcattat
ggccaaaaggcaatcctcttcctccccctgccagtttcacccgattag

DBGET integrated database retrieval system