KEGG   Podarcis muralis (common wall lizard): 114591538
Entry
114591538         CDS       T06059                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
pmua  Podarcis muralis (common wall lizard)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 DUF5663 C1_2 Acetyltransf_4
Other DBs
NCBI-GeneID: 114591538
NCBI-ProteinID: XP_028574507
LinkDB
Position
2
AA seq 373 aa
MNRPMDQEMIELKNLGLEKQLDLTRGPRGTSERPVRLERANALRISPGKVPEILSRVRQI
RLLGGQSDPKLTEELGEGHVFKPCAQSQSTWCDLCGEFIWGVYKKRLQCIHCKFICHYRC
RTLIRLDCSGPRYEDSEQNEGNEQTVEKDTNVDEQIDWDKPVLSQTEIEQRIKEYNSQIN
SNLFMSLNKDGSYTGFIKVQLKLIRPVSVPANKKAPSIQDTRKCSSRSQAVKRRTSFYLP
KDTIKHLHLISCTRASEVIEALLKKFMVVDNPRKFALFERTEKDDQVYLRKLSDEEQPLR
LRLLAGPSEKALSFVLKENETGEVNWDAFSMPELQNFLRILQREEEEHIRQILQKYSHCR
QKMQEALATRTPG
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaaccggccgatggaccaggagatgatcgagctgaagaacttggggctggagaagcag
ctcgacctgacgcggggcccgcgaggcacgtctgaacgccccgtccggctggagcgggcc
aacgccctgaggatttctccggggaaagtgcccgagatcttgagccgcgtgcgccagatc
cgactcctgggcggccagagcgaccccaaactgaccgaggagctgggcgaggggcatgtc
ttcaagccctgcgcgcaaagccagtcgacctggtgtgatctgtgcggggaattcatctgg
ggcgtgtacaagaagcgtctgcagtgcatccactgtaagttcatctgtcattaccgatgc
cgcacccttatccggctagactgcagtggccccagatatgaagacagtgaacagaatgaa
ggcaacgagcagacagtagaaaaagacaccaatgtggatgaacagatcgactgggacaag
ccagttctgtcccaaactgagattgagcaaaggataaaagaatacaacagtcagatcaac
agcaacctcttcatgagcttgaacaaagatggttcctatactggtttcatcaaggtgcaa
ttaaagctgatacggcctgtctcagtacctgccaataagaaggcgccctctatccaggac
accaggaagtgctcctcacgcagccaggcagtaaagcggcgcacctcattctacctaccc
aaggacacaatcaagcacctgcatttaatttcttgtacacgtgccagtgaggtcattgaa
gctctgctgaagaaattcatggtagttgacaatccccgcaagtttgccctctttgagaga
acagaaaaggatgaccaagtatatctccgcaagctttctgatgaggagcagcccctgcgt
ctccggctactagctggtcctagtgaaaaagcactgagctttgtcctgaaggaaaatgaa
actggagaagtcaattgggatgcctttagtatgcctgagctacagaacttcctgcgtatc
ttgcagcgtgaagaggaagagcatattcgacagatcctgcagaaatattcccattgccgc
caaaagatgcaagaggctctggccacccgcacaccaggttga

DBGET integrated database retrieval system