KEGG   Podarcis muralis (common wall lizard): 114592080
Entry
114592080         CDS       T06059                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04141  Protein processing in endoplasmic reticulum
pmua04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114592080 (ATF6B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114592080 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmua03000]
    114592080 (ATF6B)
Transcription factors [BR:pmua03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    114592080 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA
Other DBs
NCBI-GeneID: 114592080
NCBI-ProteinID: XP_028575775
LinkDB
Position
2
AA seq 690 aa
MAALASELLLLSDSSRFRADNLLSSEDWDAGLYSCLEDDGDVAAELFPCLERSIVDGGCA
HSLQFSDGFDLDMETVPPDPPWDPLHDSLFPELQVKSEPVSPASSHCSDSSTLSSSSSSS
ADLSGQAPGQADVMGVKTEQPPTPPCMYGDVLPPHFGTVQISVVPVPETGKPAASNKADS
ILSRKPPIQPKPVVVTTVPVQPAATSSKTILLQPVPVSQPQAINPAISVPAQSVVISQSE
LLHLPVSGLIKVQSPLKESLPAKPTPSAPKPETKTIVPAPTQIGPCNQEIDIKVLKRQQR
MIKNRESACQSRRKKKEYLQGLESRLREALTDNERLRRENTLLRRRLDCVLNENNELKFG
SGNRKVICVMVLLLFIAFNFGPVSISERKAADVELPKQEVEAGPGRRHLLGIAEETHDTP
EEEQEERQEEAPARLRKAQFRNLSAPFSDMKDLMLRDLDKLFLASDCRQFNRTESLRLAD
ELSGWVRRHQINRRKPSQSRKAAQASQEKPQKKPSSPSRYVPASPPRHPERNSLSQLQVY
QHPDHTEHDFMDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMALNESLY
NSSLGYEVMMQIDCEVMDTRVIHIKSSTVPPFLRRHDAATRDNRTHPSSPPAFSGRATAR
AALRAPRPTLPSGRRPPQRTLYLGEHGGGG
NT seq 2073 nt   +upstreamnt  +downstreamnt
atggcggcgctggcttcggagctgctgctgctgagcgactcgagccgtttccgcgcggat
aacctgctgagcagcgaggactgggatgcaggtctgtacagctgcctggaagatgatggg
gatgtggcagctgagctcttcccctgcctcgaacgcagcattgtggatggcggctgtgcc
cattccctgcagttcagtgatgggttcgacctggacatggaaacggtgccccccgaccca
ccttgggacccactgcacgactctctcttcccagagctgcaggtgaagtcggagcccgtc
tcccccgcctcgtcgcattgctctgattcctctacgctgtcctcttcctcctcctcctcc
gctgatctctcagggcaggcccctggccaggccgacgtgatgggagtgaagaccgagcaa
cctcccacccctccgtgcatgtatggagatgtactacccccccactttggcactgtgcag
atcagtgtcgtcccggttcctgagacagggaaaccggcagcttccaataaagccgacagc
attctcagccggaagccccccattcagccaaagccagttgtggtcaccactgtcccagtg
cagcctgcagccacgtccagtaagaccatcttattgcagcctgtacctgtgtcccagccg
caggctatcaacccagcgatttcagttccagcacagagcgttgtgatttcccagtctgag
ctgctgcatctccccgtctctgggctgatcaaggtccagtcccctctaaaggaaagtctc
ccagcaaaaccaactccctctgcccccaaaccagaaaccaaaactattgtcccggcaccg
acgcaaataggaccctgcaaccaagagattgatatcaaggtccttaaaaggcagcagcgg
atgatcaagaaccgtgaatcggcctgccagtcgcggcggaaaaagaaggaatatctgcaa
gggctggagtctcggctgcgggaggccctgacggataacgagcggctgcggcgggagaac
acgctccttcgccgccggctggactgtgtcctgaacgagaacaacgagctgaaatttggc
tctggcaaccggaaagtcatctgcgtcatggtgctgctgctcttcatagctttcaacttt
gggcctgtcagcatcagtgagcgcaaggcggcagacgtggagctgccgaagcaggaggtg
gaggctggccctggcaggaggcaccttttaggcatcgcggaggagacccacgacactcca
gaggaggagcaggaagagaggcaagaggaggccccagccaggctgagaaaggcacaattc
cgaaacctgtcggctcccttctctgacatgaaggacctgatgctgagggacttggacaag
ttgttcctcgcttccgattgccgccagttcaaccgcactgaatccctcagactggcagac
gagctcagcggctgggtccgccggcaccagatcaaccgcaggaaaccttcgcagtctcgc
aaagcagctcaggccagccaggaaaagccacaaaagaagccctctagcccctcccgctac
gtgcccgccagcccccccaggcaccctgagaggaattccctcagtcagctacaggtatac
cagcaccctgaccacacagaacacgacttcatggatgcgattgaccgccgcgaggatact
ttctacgtggtgtccttccgcagggatcacttgttgctgcctgccattagccacaacaaa
acctcccgtccaaaaatgtcactggtgatgccagccatggctctcaacgagagcctgtac
aattcgtccctgggctacgaagtgatgatgcagatagactgtgaggtcatggacacccgc
gtcatccacatcaagagctccacggtgcctcccttcctgaggcggcacgacgccgccacc
cgcgacaaccgcacccacccttcttccccgccggccttttccgggagagcgacggcccgc
gcggccttgcgggcccccaggcccaccttaccctcaggcaggcggcctccgcagcgcacc
ctgtacctgggggagcacgggggagggggctag

DBGET integrated database retrieval system