KEGG   Podarcis muralis (common wall lizard): 114592264Help
Entry
114592264         CDS       T06059                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  steroid 21-monooxygenase [EC:1.14.14.16]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00140  Steroid hormone biosynthesis
pmua01100  Metabolic pathways
Module
pmua_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    114592264
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pmua00199]
    114592264
Enzymes [BR:pmua01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     114592264
Cytochrome P450 [BR:pmua00199]
 Cytochrome P450, animal type
  CYP21 family
   114592264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 114592264
NCBI-ProteinID: XP_028576148
LinkDB All DBs
Position
2
AA seq 511 aa AA seqDB search
MHQDGGPCTHLKMLTAALLVLLLLVLALLTRRHGGFGFPKNSGRLPGPRALPFVGNLLHL
FHPDLPIHFHDLARQYGSIFRLRLGSKDMVVLNSTDLIREALLRKWSDFAGRPHGFVADL
VSLGGKDLSLGNYTPTWRLQRKMAHVAFQRCLRGNMEQIVQSQARQLCKAFHGYGGKPVD
LAQDFSLQACGIICSVLFGPLDNFTIEKLHDCIYRIMEKWGAISVQVVDALPFLKVFPNA
NLRHLLSCIKSRDALVQHVMKKHQEPHSTSEGQDMVDHMLQFQHDHEASECKGTGLVPEH
VHMAIVDMLIGGTETTATLLNWAVAFLVHRPQIQERIHEELIAVVGTSRDPTYSDREHLP
FLNATILETLRLRPSAVLALPHMTIRDTSLSGFSIPKGTTVITNLYGAHHDESKWHRPLE
FRPERFLEEDPSGEAQRQLIPFGCGARVCLGETLGRMEAFHVLAHTLRDFQILPPSPGHL
PDLRGSYRFIVHCKPFRVRLVPWAAASDLAK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaggatgggggcccctgcacccatttaaaaatgctaactgctgcgctccttgtt
ctcctcctgctggttctagccctgctgacaaggcggcatggggggttcggctttccgaag
aactcggggaggctgcccgggcctcgggccttgcccttcgttggcaatctcctccacctg
ttccatcctgaccttcccatccacttccatgacttggctcggcaatatggctccatcttc
cgccttcgccttggcagcaaagacatggtggttctgaacagcacggatctgattcgggag
gcgctgctgcggaaatggtctgattttgcaggacggcctcatggatttgttgcagacctt
gtttcgttgggaggcaaggacctctccttgggcaactatacgccgacctggcgtctgcag
agaaaaatggcccacgtagctttccagcgctgcctgcgaggaaacatggagcagattgtc
cagagccaggctcgtcagctctgcaaggctttccatggttatgggggcaaacctgtggat
ttggctcaggatttctctctgcaagcctgtgggatcatctgcagcgtcttgttcggccct
ttggacaatttcaccattgagaaactgcatgactgcatctacaggataatggaaaagtgg
ggtgcaatctctgtccaggtggtggatgccttgcccttcctcaaggtcttccccaatgcc
aatttgcgccacctgctctcctgcatcaaaagccgggatgccttggtccagcacgtgatg
aagaaacaccaggagccccacagcacctcagaaggacaggacatggtggaccacatgctg
caattccagcatgaccatgaggctagtgagtgcaaggggacgggccttgtgccggaacac
gtccacatggccattgttgacatgctcatcggaggtactgagaccacagcaactttactc
aactgggctgtggcctttttggtgcatcgcccacagatccaggagcgaatccatgaagag
ctcatagccgtggtgggaacaagccgtgaccccacctatagtgaccgggagcacctgccc
ttcttgaacgccaccatcttggagaccttgcgcttgcgcccctcggcagtccttgctttg
ccccacatgaccatccgggatacaagcttgtctggtttttccattcccaaggggacaaca
gtcatcactaatctctatggggcccatcatgatgagagcaagtggcaccgccccctggag
ttcagaccagagaggttcctggaggaggacccctcgggggaggcccagaggcaactcatt
ccattcggttgtggggcacgggtctgcctgggggagactctggggcgcatggaggctttc
cacgtccttgcacacaccctgcgggatttccagatattgcccccatcgcctggacacctc
cctgacctcagggggtcctatcggtttattgtgcattgcaagcccttcagggtgaggctg
gttccctgggcagcggcgtctgatcttgcaaaatga

DBGET integrated database retrieval system