KEGG   Podarcis muralis (common wall lizard): 114592509
Entry
114592509         CDS       T06059                                 

Gene name
NFKBIA
Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04210  Apoptosis
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04622  RIG-I-like receptor signaling pathway
pmua04623  Cytosolic DNA-sensing pathway
pmua04625  C-type lectin receptor signaling pathway
pmua04920  Adipocytokine signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114592509 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114592509 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    114592509 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    114592509 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    114592509 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    114592509 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114592509 (NFKBIA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114592509 (NFKBIA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114592509 (NFKBIA)
Transcription factors [BR:pmua03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    114592509 (NFKBIA)
Membrane trafficking [BR:pmua04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    114592509 (NFKBIA)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 114592509
NCBI-ProteinID: XP_028576521
LinkDB
Position
1
AA seq 330 aa
MFFSPGSLDYSMDITMDNHPRDALKKDRQLSLVQDDRHDSGLDSMKEEEYEKLVNELRDI
RIEPAEASAGLQSGPGQGAQAWKLQVTEDGDTFLHLAIIHEEKALSLEIIRQAGRDKAFL
NTQNNLNQTPLHLAVITDQPEIAETLLKAGCDAEIRDFRGNTPLHIVCEQGSLRGVGVLT
QYCQKQQIDSILQSSNYNGHTCLHLAAIQGYLAIVERLLSLGADVNAQEPCNGRTALHLA
VDLQNQELVSLLLKHGADVNKVTYQGYSPYQLTWGRNNSFIQEQLRQFTTLDLQMLPESE
DEESCESESEFTEDELLYDDCIIGGRHVPC
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtttttcagccccggctccctggattactctatggatataacgatggacaaccacccc
cgggacgcgctgaagaaggacaggcagctcagcctggtccaggacgaccgccacgacagc
ggcttggattccatgaaggaggaggagtacgagaagctcgtcaacgagctgagagacatt
cgcatcgagccggcggaagcctccgcggggctccagagcggccccggccagggcgcccag
gcttggaaactgcaagtgaccgaagacggagacacatttctccatctggcaattatacat
gaagaaaaggccttgagtttggaaatcattcgccaggcaggacgagacaaagccttcctg
aatacccaaaataacctcaaccagactccacttcacttggcagtgataacagaccagcca
gaaatcgcagagactcttctgaaagctggatgtgacgcagagatcagagatttccgagga
aacaccccgctgcatatagtttgcgaacaaggctctctcagaggtgtcggtgtcctcaca
cagtactgccagaaacaacaaatcgactctatcctacagtcgtccaattacaatggacac
acgtgtctccatctggcagctattcaaggttacctggccatagtagaacgcctcttgtcc
ttgggagcagatgtcaatgctcaggagccttgcaacggcaggactgccttgcatttggct
gtcgatctacagaatcaagaactggtgtcgctcctgttgaaacacggagcggatgtaaac
aaagtaacctaccagggctactctccataccagctcacatggggaagaaacaactccttc
atacaggagcagctgaggcagtttacgacgttggacctgcagatgctaccagaaagtgaa
gacgaagagagctgtgaatcggagtcagagttcacagaggatgaactcctgtatgacgac
tgcatcattggcggacgacatgtgccttgctaa

DBGET integrated database retrieval system