KEGG   Podarcis muralis (common wall lizard): 114592791
Entry
114592791         CDS       T06059                                 

Definition
(RefSeq) tumor necrosis factor-like
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04060  Cytokine-cytokine receptor interaction
pmua04150  mTOR signaling pathway
pmua04210  Apoptosis
pmua04217  Necroptosis
pmua04350  TGF-beta signaling pathway
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04622  RIG-I-like receptor signaling pathway
pmua04625  C-type lectin receptor signaling pathway
pmua04920  Adipocytokine signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114592791
   04350 TGF-beta signaling pathway
    114592791
   04150 mTOR signaling pathway
    114592791
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114592791
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114592791
   04217 Necroptosis
    114592791
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114592791
   04621 NOD-like receptor signaling pathway
    114592791
   04622 RIG-I-like receptor signaling pathway
    114592791
   04625 C-type lectin receptor signaling pathway
    114592791
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    114592791
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114592791
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114592791
Cytokines and growth factors [BR:pmua04052]
 Cytokines
  Tumor necrosis fators
   114592791
Glycosaminoglycan binding proteins [BR:pmua00536]
 Heparan sulfate / Heparin
  Cytokines
   114592791
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 114592791
NCBI-ProteinID: XP_028576894
LinkDB
Position
2
AA seq 236 aa
MSSEHLVYDVEKGSNVVVVREKPQKESHWKCLSICSLLLLLGATFVFALLQFGAFKQSES
QDSKEKGSPFSGGLPQTMKVQALMSRKPAAHALASRAHGQQLFWTTDVAPSILENGMQLN
KNDNSLVVPSTGLYFVYSQVMFHSDTCPESPLLLSHTISWFSSQFNKNVELLKSIKSACE
GGRTAQGQKSLWFESIYQGAVFRLNKGDRLWSKTESPQYLDFAQQGQIYFGIVAME
NT seq 711 nt   +upstreamnt  +downstreamnt
atgagctccgagcatttggtgtacgacgtggagaaagggagcaacgtggtggtggtgcgc
gaaaagccgcagaaggagagccactggaaatgcctcagcatctgctccctcctgctgctg
ctgggcgccaccttcgtctttgcgcttttgcagtttggcgctttcaagcagtctgaatcc
caggactctaaggaaaagggaagcccattttctggagggttgccgcagacgatgaaagtt
caagccctgatgtccaggaaaccagctgcccatgccctagcttcccgagctcacggccag
caattgttctggaccacagacgtggcgccctccatacttgagaatggcatgcagctgaac
aaaaatgacaactccctcgtggtgccttcgaccggactctattttgtctactctcaggtc
atgttccatagcgacacctgcccggaatctcctctgctgctcagccacaccatctcgtgg
ttttcctcacagttcaacaagaatgtggaattgctgaagtccatcaagtccgcttgcgag
ggcggaagaaccgcccagggccaaaagagtttgtggttcgaatccatttaccagggggct
gtcttcaggttgaacaaaggggaccgcctgtggtccaaaaccgaatctcctcagtatctg
gactttgcccaacagggacagatctattttgggatcgttgccatggagtaa

DBGET integrated database retrieval system