KEGG   Podarcis muralis (common wall lizard): 114592871
Entry
114592871         CDS       T06059                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04080  Neuroactive ligand-receptor interaction
pmua04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114592871 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114592871 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pmua04030]
    114592871 (LPAR2)
G protein-coupled receptors [BR:pmua04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    114592871 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 114592871
NCBI-ProteinID: XP_028576985
LinkDB
Position
2
AA seq 246 aa
MTRCYYNETIEFFYNNSGKELSRVWRNKDVLVVVLGLTVSIIVLLTNLLVITAIAINKRF
HYPIYYLLGNLAAADLFAGIAYLFLMFHTGPNTAQLSLKTWFVRQSLLDTSLTASVVNLL
AIAVERHQTVFTMQLHSKMSNQRVIILIVCIWLTALLLGLIPSYGWHCLCSLKDCSRMAP
LYSRRYLTFWAISNLFIFLIMVVVYTHIFIYVKRKMARMSRHTSFHPRYRETMINLIKTV
IIILSK
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccaggtgttactacaacgagaccattgagttcttctacaacaacagtggcaaggag
ctgtcccgagtgtggaggaacaaggatgttctggtggttgttctgggcctgacggtcagc
atcattgtgcttctcaccaacctgctggtcattacagccattgcgatcaacaagcgcttc
cattatccgatctattacctgctggggaatctggctgctgccgacctctttgccggcatt
gcttatttgttcctgatgttccacacgggacccaacacagcccagctttctctcaagact
tggtttgtcaggcagagcctcctggataccagcctgacagcctctgtggtcaacctcctg
gccattgcggtggagcgacaccagacagtgttcaccatgcagctccatagcaagatgtcc
aaccagcgagtcataatcctcattgtctgcatctggctaacagctctgctgcttggcctc
atcccctcatacggctggcactgtctgtgtagcctgaaggactgctcaaggatggctccg
ctctacagccgaaggtacttgaccttttgggccatctccaacctcttcatcttcctcatc
atggtggtagtctacactcacattttcatctacgtcaagaggaagatggctcgcatgtcc
aggcacaccagcttccatccgcgttacagggagaccatgatcaatctcatcaagacagtt
atcattatcctcagtaagtaa

DBGET integrated database retrieval system