KEGG   Podarcis muralis (common wall lizard): 114593429
Entry
114593429         CDS       T06059                                 

Definition
(RefSeq) interleukin-6-like
  KO
K05405  interleukin 6
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04060  Cytokine-cytokine receptor interaction
pmua04068  FoxO signaling pathway
pmua04218  Cellular senescence
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04623  Cytosolic DNA-sensing pathway
pmua04625  C-type lectin receptor signaling pathway
pmua04672  Intestinal immune network for IgA production
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114593429
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114593429
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    114593429
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114593429
   04621 NOD-like receptor signaling pathway
    114593429
   04623 Cytosolic DNA-sensing pathway
    114593429
   04625 C-type lectin receptor signaling pathway
    114593429
   04672 Intestinal immune network for IgA production
    114593429
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114593429
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114593429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmua04052]
    114593429
Cytokines and growth factors [BR:pmua04052]
 Cytokines
  Interleukins
   114593429
SSDB
Motif
Pfam: IL6 GCSF
Other DBs
NCBI-GeneID: 114593429
NCBI-ProteinID: XP_028577597
LinkDB
Position
3
AA seq 184 aa
MAEAQTASMPFEKELGATPEALPLATWLIKKTTKLYKTLCNLRGTCDTDWSHLPQEHLLI
PEIPSEGKCSPSTFEKEGCLELLAEGLFSFRIFLEYLQETLFPKKPELTRYLWPATKFLA
NNLKSQLQNPDGMKPIPDAIDDDLAHKLAMHTGWTPAILRHTILRRYLKFMDTAASAIRY
INTS
NT seq 555 nt   +upstreamnt  +downstreamnt
atggctgaggctcagactgctagcatgccttttgagaaagaattaggtgccactcccgaa
gccttgcctttggctacctggctaataaaaaagactaccaagttgtataaaacgctgtgt
aatctgcgaggcacatgtgataccgattggagtcatctgcctcaggaacatttgcttatc
ccagagatccctagcgaaggtaaatgctccccctctacatttgaaaaggaaggatgcctg
gaactccttgcagagggacttttttcatttaggatatttttggaatacctgcaggaaact
ttatttcccaagaaaccggagctaactcggtacttgtggccagcaacaaagtttctggcc
aataacttgaagtcacagctgcagaatcctgacggcatgaaacctatacctgatgccatt
gacgatgatcttgctcataagctagcaatgcatactggttggacacctgcaattctcagg
cacaccatacttagaaggtacctgaagtttatggatacagctgcaagtgcaattcggtac
ataaacacatcatag

KEGG   Podarcis muralis (common wall lizard): 114593430
Entry
114593430         CDS       T06059                                 

Definition
(RefSeq) interleukin-6-like
  KO
K05405  interleukin 6
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04060  Cytokine-cytokine receptor interaction
pmua04068  FoxO signaling pathway
pmua04218  Cellular senescence
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04623  Cytosolic DNA-sensing pathway
pmua04625  C-type lectin receptor signaling pathway
pmua04672  Intestinal immune network for IgA production
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114593430
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114593430
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    114593430
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114593430
   04621 NOD-like receptor signaling pathway
    114593430
   04623 Cytosolic DNA-sensing pathway
    114593430
   04625 C-type lectin receptor signaling pathway
    114593430
   04672 Intestinal immune network for IgA production
    114593430
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114593430
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114593430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmua04052]
    114593430
Cytokines and growth factors [BR:pmua04052]
 Cytokines
  Interleukins
   114593430
SSDB
Motif
Pfam: IL6 GCSF
Other DBs
NCBI-GeneID: 114593430
NCBI-ProteinID: XP_028577598
LinkDB
Position
3
AA seq 184 aa
MAEAQTASMPFEKKLGATPEALPLASWLLKKTTKLYKRLCNLRGTCETDWSHLPQEHLLI
PEIHSESKCSPSTFEKEGCLELLAEGLFSFRIFLEYLQETLFPKKPELTQYLWPATEFLA
NNLKSQLKNPDCMQPIPDAIDDDLAHKLAMHTGWTPAILRHTILRRYLMFMDTAASAIRY
INTS
NT seq 555 nt   +upstreamnt  +downstreamnt
atggctgaggctcagactgctagcatgccttttgagaaaaaattaggtgccactcctgaa
gccttgcctttggcttcctggctactaaaaaagactaccaagttgtataaaaggctgtgt
aatctgcgaggcacatgtgaaaccgattggagtcatctgcctcaggaacatttgcttatc
ccagagatccatagcgaaagtaaatgctccccctctacatttgaaaaggaaggatgcctg
gaactccttgcagagggacttttttcatttaggatatttctggaatacctgcaggaaact
ttatttcccaagaaaccggagctaactcagtacttgtggccagcaacagagtttctggcc
aataacttgaagtcacagttgaagaatcctgattgcatgcaacctatacctgacgccatt
gacgatgatcttgctcataagctagcaatgcatactggttggacacctgcaattctcagg
cacaccatacttagaaggtacctgatgtttatggatacagctgcaagtgcaattcggtac
ataaacacatcatag

KEGG   Podarcis muralis (common wall lizard): 114607734
Entry
114607734         CDS       T06059                                 

Gene name
IL6
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-6
  KO
K05405  interleukin 6
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04060  Cytokine-cytokine receptor interaction
pmua04068  FoxO signaling pathway
pmua04218  Cellular senescence
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04623  Cytosolic DNA-sensing pathway
pmua04625  C-type lectin receptor signaling pathway
pmua04672  Intestinal immune network for IgA production
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114607734 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114607734 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    114607734 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114607734 (IL6)
   04621 NOD-like receptor signaling pathway
    114607734 (IL6)
   04623 Cytosolic DNA-sensing pathway
    114607734 (IL6)
   04625 C-type lectin receptor signaling pathway
    114607734 (IL6)
   04672 Intestinal immune network for IgA production
    114607734 (IL6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114607734 (IL6)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114607734 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmua04052]
    114607734 (IL6)
Cytokines and growth factors [BR:pmua04052]
 Cytokines
  Interleukins
   114607734 (IL6)
SSDB
Motif
Pfam: IL6 IL11 GCSF PRF
Other DBs
NCBI-GeneID: 114607734
NCBI-ProteinID: XP_028606998
LinkDB
Position
12
AA seq 195 aa
MPVGDSSGESEFSDDSSARTVPPERLQLQKCVDLARWLQGRAAGLTRELCKKEAACQGKM
ELTLNNLNLPKITQEDKCYDTGFEKETCLGRLSSGLYAFGTFFEYLEEASVETAETFRPS
TQHLANTLRSMMNNPETVTLPDPAAQKILAAKLREHRGWTVTVIKHFILQDFTLFMQKTT
RALRVLXEARSSGAF
NT seq 588 nt   +upstreamnt  +downstreamnt
atgcccgtcggggattcctccggggagtccgaattcagcgacgactcctcggccaggacg
gtgccgcccgagcgcctccagctgcagaaatgcgtggacctggcgcgctggctgcaggga
agagcggccggcttgactcgagagctatgtaagaaggaggccgcctgtcaaggcaagatg
gaactgaccctgaataatctcaaccttccaaagatcactcaagaagataaatgctatgac
actggatttgaaaaggaaacatgtctgggaagactttcaagtggtctttatgctttcggg
acattctttgaatatttagaagaggcttctgttgagactgcagaaacctttcggccaagc
acacagcacctggcaaataccttgagatcaatgatgaacaatcctgaaactgtgaccttg
ccggatccagccgctcagaaaattcttgccgcaaagcttcgagaacacagaggctggact
gttacagttatcaaacacttcatacttcaagattttactttatttatgcagaaaactaca
agggctctccgtgtcttatgagaggccaggagttctggtgccttttaa

DBGET integrated database retrieval system