KEGG   Podarcis muralis (common wall lizard): 114593961
Entry
114593961         CDS       T06059                                 

Gene name
MAP3K7
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7 isoform X1
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04140  Autophagy - animal
pmua04310  Wnt signaling pathway
pmua04520  Adherens junction
pmua04620  Toll-like receptor signaling pathway
pmua04621  NOD-like receptor signaling pathway
pmua04622  RIG-I-like receptor signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114593961 (MAP3K7)
   04310 Wnt signaling pathway
    114593961 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114593961 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    114593961 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114593961 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    114593961 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    114593961 (MAP3K7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114593961 (MAP3K7)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114593961 (MAP3K7)
Enzymes [BR:pmua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     114593961 (MAP3K7)
Protein kinases [BR:pmua01001]
 Serine/threonine kinases: TKL group
  MLK family
   114593961 (MAP3K7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 114593961
NCBI-ProteinID: XP_028578820
LinkDB
Position
3
AA seq 616 aa
MSSANSADMIETPPVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESE
RKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHA
MSWCLQCSQGVAYLHSMKPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNK
GSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPP
LIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMQYFPGAEEPLQYPCQYSDEGQS
NSATSTGSFMDMTSTNTSNKSDANMEPNDFPGTATNDTIKRLESKLAQQMKNSAKQSGEP
GRLSLPPSRGSSVESLSEVRGRPQSTLVSGESKRMSADMSEIEARIAATTAFSKPKRGHR
KTASFGNILDVPEIIKPAGNGQQRRRSIQDLSVAGTDSNQESRNNSRSSSPSVRMITTSG
PTSEKPARSLPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLQPCPNSESMAVFEQHCKMA
QEYMKVQTEIALLLQRKQELIAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKK
QLEVIRNQQQKRQGTS
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgtcttctgccaactccgcggacatgattgaaacccccccggtgctcaacttcgaagaa
attgactacaaagagatcgaggtggaagaggttgttggaagaggagcctttggagtagtt
tgcaaagcaaaatggcgagcaaaagatgtggccattaaacaaatagaaagtgaatcggaa
cgaaaagctttcatagtagagcttcgacagttgtcacgtgtgaaccatcctaatattgtc
aagttatatggagcttgtttgaacccagtttgtcttgttatggaatatgctgaaggaggt
tctctgtataatgtcctacatggtgctgaacctctgccttactacactgctgcacatgca
atgagttggtgtttacagtgttcccagggagtggcataccttcatagcatgaaaccgaag
gctctaattcacagggacctaaaaccaccaaacttgctcttggtggcaggggggacagtt
ctgaaaatctgtgattttggtacagcctgtgatattcagacacacatgaccaacaataag
ggaagtgctgcttggatggcaccagaagtttttgaaggtagcaattacagtgaaaaatgt
gatgtattcagttggggtattattctttgggaagtgattacccgtagaaaaccttttgat
gagattggtggtcctgcgtttcgaatcatgtgggcagttcacaatggtactaggccacca
ctgataaaaaatttacccaagcctattgagagcttaatgactcgctgttggtcaaaagat
ccctcacaacgaccttcaatggaagaaattgtcaaaataatgacacatttgatgcagtac
tttccaggagcagaggaacccctacaatacccttgtcagtattctgatgaaggccaaagc
aactctgccactagcacaggttccttcatggatatgacttccacaaatactagtaacaag
agtgatgccaacatggaaccaaatgactttccaggaactgctaccaatgacactattaaa
cgcttggagtcaaaactggcccagcagatgaaaaattcagcaaagcagtcgggagagcct
ggccgtttgagcttacctccatctcgcggtagcagtgtcgagagcttgtcagaagttcgt
gggcgaccacagtcaacccttgtttcgggagaaagcaaacgaatgagtgctgatatgtct
gaaattgaagcaagaattgctgctaccacagccttttccaaacctaaacgaggccatcgt
aaaactgcttcatttggcaacattctggatgtcccagagatcatcaaaccagcaggcaac
ggacaacagaggcgcagatctattcaagaccttagtgttgctggaacagattccaaccag
gaaagcagaaacaacagtagatcatctagtcctagtgtgagaatgatcactacatcggga
ccaacctctgaaaagccagctcgcagtcttccatggacacctgatgactctacagatacc
aatgggtctgataactccatcccaatggcatatcttacattagatcaccaattgcagcct
ttacagccatgtccaaattcagaatctatggctgtgtttgaacagcactgtaaaatggca
caagaatatatgaaagttcagacagaaattgcattgctgttgcaaagaaagcaagaacta
atagcagaactggaccaggatgaaaaagaccagcaaaatacatcacgtctggtacaagag
cataaaaagcttttagacgaaaataaaagtctttccacgtactaccagcaatgcaaaaaa
cagttggaagttatccgaaatcagcaacaaaaacgtcaagggacatcatga

DBGET integrated database retrieval system