KEGG   Podarcis muralis (common wall lizard): 114594443
Entry
114594443         CDS       T06059                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04012  ErbB signaling pathway
pmua04068  FoxO signaling pathway
pmua04140  Autophagy - animal
pmua04150  mTOR signaling pathway
pmua04210  Apoptosis
pmua04218  Cellular senescence
pmua04261  Adrenergic signaling in cardiomyocytes
pmua04370  VEGF signaling pathway
pmua04371  Apelin signaling pathway
pmua04510  Focal adhesion
pmua04620  Toll-like receptor signaling pathway
pmua04625  C-type lectin receptor signaling pathway
pmua04910  Insulin signaling pathway
pmua04914  Progesterone-mediated oocyte maturation
pmua04920  Adipocytokine signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114594443 (AKT3)
   04012 ErbB signaling pathway
    114594443 (AKT3)
   04370 VEGF signaling pathway
    114594443 (AKT3)
   04371 Apelin signaling pathway
    114594443 (AKT3)
   04068 FoxO signaling pathway
    114594443 (AKT3)
   04150 mTOR signaling pathway
    114594443 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114594443 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    114594443 (AKT3)
   04218 Cellular senescence
    114594443 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114594443 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114594443 (AKT3)
   04625 C-type lectin receptor signaling pathway
    114594443 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114594443 (AKT3)
   04920 Adipocytokine signaling pathway
    114594443 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    114594443 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114594443 (AKT3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114594443 (AKT3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114594443 (AKT3)
Enzymes [BR:pmua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114594443 (AKT3)
Protein kinases [BR:pmua01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   114594443 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 114594443
NCBI-ProteinID: XP_028579960
LinkDB
Position
3
AA seq 499 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFAGVNWQDVYDKKVVL
KFHVLVPHFLTRVLQKLLLPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCM
DNERRPHFPQFSYSASGRE
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgagcgatgttacaattgtgaaagaaggttgggttcagaaaaggggtgaatatataaaa
aactggaggccaagatacttcctattgaagacagatggctctttcataggctataaggaa
aagccgcaagatgtggatctaccatatcctcttaacaacttttctgtagcaaaatgccag
ctaatgaaaacagagagaccaaaaccaaacacatttattatccgatgtcttcaatggacc
actgtgatagaaaggacatttcacgtagatactccagaagaacgggaagaatggacagaa
gccatccaagcagtagcagacaggcttcagaggcaggaagaagaaagaatgaactgtagt
ccaacctcacagattgataatataggagaggaggagatggatgcttccacaacccaccat
aaaaggaagacaatgaatgattttgattacttaaaactacttggcaaaggcacgtttggc
aaagttattctggttcgagagaaggcaagtggaaaatattatgctatgaagattttgaaa
aaggaagttattattgcaaaggatgaagtggctcacacacttacagaaagcagagtactg
aaaaacactagacatccttttttgacgtctttaaaatactcattccagacaaaggaccgt
ttgtgttttgtgatggaatacgtcaatggaggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggatcgcacacgcttctatggtgcagaaattgtttctgctttggac
tatctgcattctggaaagattgtgtaccgtgatctcaagttagagaatctaatgttggat
aaagatggacacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gctactatgaaaacgttctgtggcaccccagagtacttggctccagaggttttggaagac
aatgactatggccgtgcagtggattggtggggccttggagttgttatgtatgaaatgatg
tgtggcaggttgccattctacaaccaagatcatgaaaaactttttgaactaatactaatg
gaggatataaaatttccccgaacattgtcatccgatgcaaaatcactactttcaggtctc
ctgataaaagatccaaataaacgtcttggtggaggaccagatgatgctaaagaaattatg
cgacacagtttctttgctggagtgaactggcaagatgtatatgataaaaaggtggtgttg
aagttccatgtgctggttcctcatttcttgacaagagttcttcagaagctgcttctccct
ccttttaaacctcaagtgacgtctgagacagacaccagatattttgatgaagagtttact
gctcagactattacaataacaccacctgaaaaatatgatgaagatggtatggactgcatg
gacaacgaaagacgaccacatttcccccagttttcttattctgcaagtggacgggaatag

KEGG   Podarcis muralis (common wall lizard): 114603190
Entry
114603190         CDS       T06059                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04012  ErbB signaling pathway
pmua04068  FoxO signaling pathway
pmua04140  Autophagy - animal
pmua04150  mTOR signaling pathway
pmua04210  Apoptosis
pmua04218  Cellular senescence
pmua04261  Adrenergic signaling in cardiomyocytes
pmua04370  VEGF signaling pathway
pmua04371  Apelin signaling pathway
pmua04510  Focal adhesion
pmua04620  Toll-like receptor signaling pathway
pmua04625  C-type lectin receptor signaling pathway
pmua04910  Insulin signaling pathway
pmua04914  Progesterone-mediated oocyte maturation
pmua04920  Adipocytokine signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114603190 (AKT2)
   04012 ErbB signaling pathway
    114603190 (AKT2)
   04370 VEGF signaling pathway
    114603190 (AKT2)
   04371 Apelin signaling pathway
    114603190 (AKT2)
   04068 FoxO signaling pathway
    114603190 (AKT2)
   04150 mTOR signaling pathway
    114603190 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114603190 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    114603190 (AKT2)
   04218 Cellular senescence
    114603190 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114603190 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114603190 (AKT2)
   04625 C-type lectin receptor signaling pathway
    114603190 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114603190 (AKT2)
   04920 Adipocytokine signaling pathway
    114603190 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    114603190 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114603190 (AKT2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114603190 (AKT2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114603190 (AKT2)
Enzymes [BR:pmua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114603190 (AKT2)
Protein kinases [BR:pmua01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   114603190 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C PH_11
Other DBs
NCBI-GeneID: 114603190
NCBI-ProteinID: XP_028597828
LinkDB
Position
8
AA seq 481 aa
MNEVSVVKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKEKPETSDHSLPPLNDFSVAEC
QLMKVERPRPNTFIIRCLQWTTVIERTFHVDSPDEREEWIRAIQMVANSLKNQEPEEDRM
DYKCGSPSDSTGAEEMEVAVTKTRAKATMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTNDRLCFVMEYANGGELFFH
LSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKALLAGLLKKDPKQRLGGGPNDAREVMEHRFFAAINWQDVVQK
MLIPPFKPQVTSEIDTRYFDDEFTAQSITITPPDRYDTLDSLEADQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaatgaggtgtcggtcgtcaaggagggctggttgcacaagagaggggaatacatcaaa
acgtggaggcccaggtactttctcctgaaaagcgatgggtctttcattgggtacaaggag
aagccggagacgtcagaccacagcctgccccctttgaatgacttctctgtggcagaatgc
cagctgatgaaagtcgaacggccccgtcccaacaccttcatcatccgctgcttgcagtgg
acaaccgtcatcgaaaggacgttccacgtcgactcccccgatgagcgggaggagtggatc
cgggccatacagatggtcgccaacagcttgaagaaccaggagccggaagaggacaggatg
gactacaagtgtggctctcccagcgacagcacaggcgccgaggagatggaggtggccgtg
accaagacccgggccaaggcgaccatgaatgactttgactacctgaagctccttgggaag
ggcactttcgggaaggtcatcctcgtgcgggaaaaggccacagggcgctactacgccatg
aagatcctgcgcaaggaagtcatcattgccaaggacgaggtggcccacaccgtcacagag
agcagagtcctgcagaacacgaggcatccgttcctcacggcgctgaagtacgccttccag
accaacgaccgcctctgcttcgtcatggagtatgccaacggaggggagctgtttttccac
ctttcgagggagcgagtcttcacagaggaccgtgcccgtttctacggggctgaaattgtt
tccgccttggagtacctgcactcccgggacgtcgtctatcgtgacatcaagctggagaat
ctcatgctggacaaggacgggcacataaagatcacagactttgggctgtgcaaggagggc
atcagtgacggcgccaccatgaagactttctgcgggacgccggagtacttggcccctgag
gtgctggaggacaatgactacgggcgcgccgtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgtgggcgcctgcccttctacaaccaagaccacgagcgcctctttgag
ctcatcctcatggaggagatccgcttccctcgcacgctcagccccgaggccaaggccctg
ctggccgggctgctcaagaaggaccccaagcagaggttggggggcggccccaacgacgcc
cgggaggtgatggagcaccgcttctttgccgccatcaactggcaggacgtggttcagaaa
atgctcatcccgcccttcaagccgcaggtgacttctgagatcgacacccggtactttgac
gacgagttcacagcacagtccatcaccatcacccctcctgaccgatacgacaccttggac
tcgctagaggccgaccagcggacccacttcccccagttctcctactcggccagcatccgg
gaatag

KEGG   Podarcis muralis (common wall lizard): 114605978
Entry
114605978         CDS       T06059                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua04010  MAPK signaling pathway
pmua04012  ErbB signaling pathway
pmua04068  FoxO signaling pathway
pmua04140  Autophagy - animal
pmua04150  mTOR signaling pathway
pmua04210  Apoptosis
pmua04218  Cellular senescence
pmua04261  Adrenergic signaling in cardiomyocytes
pmua04370  VEGF signaling pathway
pmua04371  Apelin signaling pathway
pmua04510  Focal adhesion
pmua04620  Toll-like receptor signaling pathway
pmua04625  C-type lectin receptor signaling pathway
pmua04910  Insulin signaling pathway
pmua04914  Progesterone-mediated oocyte maturation
pmua04920  Adipocytokine signaling pathway
pmua05132  Salmonella infection
pmua05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114605978 (AKT1)
   04012 ErbB signaling pathway
    114605978 (AKT1)
   04370 VEGF signaling pathway
    114605978 (AKT1)
   04371 Apelin signaling pathway
    114605978 (AKT1)
   04068 FoxO signaling pathway
    114605978 (AKT1)
   04150 mTOR signaling pathway
    114605978 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114605978 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    114605978 (AKT1)
   04218 Cellular senescence
    114605978 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114605978 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114605978 (AKT1)
   04625 C-type lectin receptor signaling pathway
    114605978 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114605978 (AKT1)
   04920 Adipocytokine signaling pathway
    114605978 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    114605978 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114605978 (AKT1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114605978 (AKT1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    114605978 (AKT1)
Enzymes [BR:pmua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114605978 (AKT1)
Protein kinases [BR:pmua01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   114605978 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 114605978
NCBI-ProteinID: XP_028603555
LinkDB
Position
1
AA seq 480 aa
MNEVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEERDEWTKAIQTVADSLKKQEEEIMDF
RSGSPSDNSGAEEMEISMTKPKHKVTMTEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILSEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGQDDAKEIMQHKFFAGIVWQDVYEKK
LIPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMDYVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgaatgaagttgcaatagtgaaagagggctggctccacaaacgaggggagtacattaaa
acatggaggccaaggtatttcctgttgaaaaatgatggaacgttcattggctacaaggag
cgaccgcaagatgtggaccagagagaatcccccttaaataacttttctgtggctcagtgc
cagttgatgaagacagagagacccaaaccaaacacattcatcatccggtgcctgcagtgg
actacagtaattgaaagaacgtttcatgtggagactccggaggagcgggatgaatggaca
aaagccatccaaaccgtggcagacagccttaagaaacaagaagaggaaataatggatttt
cgatccggttcgcccagcgataattcaggcgccgaagaaatggaaatttctatgacaaag
ccaaaacacaaagtaactatgactgaatttgagtatcttaaacttctggggaaaggtacc
tttggaaaggtgatcctggtaaaagaaaaagcaaccgggcgatattacgccatgaaaatt
ctgaagaaggaagtcattgtcgcaaaggatgaagtggctcatacgctgacagaaaaccgt
gttttgcagaactctagacatcctttcttaacggctttgaagtattccttccagacgcac
gaccgcttgtgctttgttatggagtacgctaacggaggggagctgttcttccatctatcg
agagagcgtgtcttttctgaagaccgggcccggttctatggggctgagattgtatctgct
ctagactacctgcactcggagaagaacgtggtttatagagatttaaagttggaaaacttg
atgctggataaagacgggcacataaaaataacagactttgggctctgcaaagaagggatc
aaagatggagcaacgatgaagactttctgtggcaccccggaataccttgcgccagaggtg
ctggaggacaacgactacggccgtgcggtggattggtggggcttaggggtcgtcatgtac
gaaatgatgtgcggccggctccctttctacaaccaggaccacgagaagctcttcgagctc
attctcagcgaagagatccggttcccacgcacgttatcgcccgaagcaaagtcgcttctg
tcgggcttgctgaagaaggatccgaagcaaaggttaggcggtggacaggatgacgccaag
gagattatgcaacacaaattttttgctggcatcgtatggcaagatgtgtatgaaaaaaag
ctcataccaccatttaaaccacaggtgacatctgaaacggacacgcgctactttgatgaa
gaattcacagcacagatgatcactatcacccctcctgatcaagatgacaatatggattac
gtcgatagcgagcgacgaccacacttccctcagttctcttactcggccagcggaacggct
tag

DBGET integrated database retrieval system