KEGG   Podarcis muralis (common wall lizard): 114594931
Entry
114594931         CDS       T06059                                 

Definition
(RefSeq) adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pmua  Podarcis muralis (common wall lizard)
Pathway
pmua00230  Purine metabolism
pmua01100  Metabolic pathways
pmua04020  Calcium signaling pathway
pmua04114  Oocyte meiosis
pmua04261  Adrenergic signaling in cardiomyocytes
pmua04270  Vascular smooth muscle contraction
pmua04371  Apelin signaling pathway
pmua04540  Gap junction
pmua04912  GnRH signaling pathway
pmua04914  Progesterone-mediated oocyte maturation
pmua04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114594931
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    114594931
   04020 Calcium signaling pathway
    114594931
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    114594931
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114594931
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    114594931
   04914 Progesterone-mediated oocyte maturation
    114594931
   04916 Melanogenesis
    114594931
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114594931
   04270 Vascular smooth muscle contraction
    114594931
Enzymes [BR:pmua01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     114594931
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 114594931
NCBI-ProteinID: XP_028581051
LinkDB
Position
3
AA seq 1122 aa
MPRNRAFSEPEYSAEYSADYSVSLPSDPEHGVGRTHEVTVRNSGSCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVVVMCTVVYTAEKLPTTLAASVGLAAHIL
LFVLCKYQLLPDRVTRKFMPYILWILIAAQIFCYLGLNYARYHEASDTVGWQAFFVFSFF
LTLPLRLTPIVLISAVTCAIHTLVLGVTIAQQQQLQLSQESILGGYLLWQILSNVAIYLC
TICVGIMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQEGLMLSILPRHVADEMLKDM
KKDASQKEMQQFNTMYMYRHENVSILFADIVGFTQLSSYCSAQELVKLLNELFARFDKLA
AKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVDAISYVREKTKTDVDMRVGV
HSGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGDG
GARCEYLKEKGIVTYLIVVTNKPLKNGINGVKLSVSSSHGESPQLINTKECNGSINTTCT
TPDEAEESDTRVVNPSFPNPRRRLRLRDLAERVVDASENEQELNKLLNEALLERESVQAM
KGRSTYRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEIFIDPQLMTNYVT
FVVGEVLLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMSAIFILTMANIVD
MLSCQQYYKDTFYNSTMQALLDGGCVENPKYYSYITVLALIATIMLVQVSHMVKLTLMLM
ITGSVGVVNIVAWEHIFDKYDEERFQESRSSLIPSKYSMTAMILVMMLSFYYFSRHVEKL
ARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPDHVARHFLGSKKRDEELYSQSYDEIG
VMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDDPQFRCITKIKTIGSTYMA
ASGVTPDVNTNGYNNAVKKEELSEKERWQHLADLADFALAMKETLMNINYQSFNNFMLRI
GMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHFILKEYGFRFVR
RGHIFVKGKGDLLTYFMKGREKQGSFVNGSCVTLPHQVVDSS
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgcctcggaacagggccttctccgagcccgagtactcggcggagtactcggccgattac
tcggtcagcttgccgtccgaccccgagcatggcgtcgggcgcacccacgaggtgacggtg
aggaactctggctcctgcctctgcctgccgcgattcatgcgcctgacgttcgccccggaa
tccctggagaacctctaccagacttacttccgcaggcagcgccacgagacccttctggtc
ttggtggtctttgccgcactcttcgactgctacgtcgtcgtcatgtgcacggtggtctac
accgccgagaagctgcccaccaccctggcggcctcggtggggctggccgcccacatcctc
ctcttcgtcctatgcaagtaccagctcctaccggaccgcgtcacccgcaaattcatgccc
tacatcctgtggatcctcatagctgcccagatattctgctacctgggcctgaactatgcc
cgctaccacgaggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
ctcaccctccctctgcgcctcacgcccatcgtcctcatctcggccgtcacctgcgccatc
cacaccctggtgctgggcgtcaccatagcgcagcagcagcagctgcagctgagtcaagaa
tccatcctgggagggtatttgctgtggcagatcttgtccaacgttgccatctacctgtgt
accatctgcgtgggcatcatgtcgtactacatggcggatcgtaagcaccgcaaagccttc
ctggaagctcgtcagtctctggaggtcaagctcaaccttgaggagcaaagccagcagcag
gaaggcctgatgctgtcgattttgcccaggcacgtagctgacgagatgctcaaggatatg
aagaaggatgccagccagaaggagatgcagcagtttaacaccatgtacatgtaccgccat
gagaacgtcagcatcctctttgcggacatcgtgggtttcacgcagctctcgtcctactgc
agcgcccaggaattggtgaagcttctgaacgagctcttcgctcgcttcgacaaattagca
gcgaaataccaccagctgcgtatcaagatcctgggagactgctactactgcatctgcggc
ctgcctgattaccgggaagaccacgccgtctgttctatcctaatgggccttgctatggtg
gacgcgatttcctacgtccgagagaagaccaaaacagacgtggacatgcgcgtgggggtc
cacagcggcaccgtcctgggcggggtcctcggccagaagcgctggcagtacgatgtgtgg
tccacagacgtgacggtggcaaataagatggaggccggcggcatcccagggcgtgtgcac
atttctcagagcaccatggactgcctgaagggggagtttgaggtggagccgggagacggc
ggggcccgctgtgaatacctgaaggagaaggggatcgtcacctacctcatagtggtgacc
aacaagccgctcaagaacgggatcaacggcgtgaagctgtccgtctcttcctcgcacggc
gagtcaccacagctgatcaacaccaaggagtgcaacgggagcatcaacaccacttgcacg
acccccgacgaggccgaggagtcggacaccagggtggtgaatccctccttccccaacccg
cggcggcgcctgcgcttgcgtgacctggccgagagggtggtggacgcctccgagaacgaa
caggagctcaacaagctgctgaacgaggccttgttggagagggagtcggtgcaggcgatg
aagggcagatccacctatcgactctccatgcgcttcatcgaccccgagatggagacccgg
tactccgtggaaaaggagaagcagagcggggcggccttcagctgttcctgcgtcgtcctc
ttcttcaccgccctcgtggagatcttcattgatccacagctgatgacaaattatgtgacg
ttcgttgtcggggaggtcttgctgctcatccttaccctctgctctctggctgccatcttc
cccagggttttccctaagaagcttgtggctttttccacgtggatcgacagaacgaggtgg
gccaggaacacctgggccatgtctgccattttcatcctcaccatggcgaacatcgtagac
atgctcagctgccagcagtattacaaagacaccttttacaacagcacgatgcaggcactg
ctggacgggggctgcgtggagaaccccaagtactacagctacatcaccgtgttggcgctc
atcgcgaccatcatgctggtgcaagtcagccacatggtcaagctcaccctgatgctcatg
attaccggttcggtgggagtggtcaacatcgtggcctgggagcacatcttcgacaaatat
gatgaggaacggttccaagagagcaggtcctcactgattccgtccaaatattcaatgaca
gcgatgatcttagtgatgatgctcagcttctactatttctcgcgccatgtggagaagctg
gccaggactttattcctgtggaagatagacgttcatgaccagaaggagcgggtctatgag
atgaggcgctggaacgaggccttggtcaccaacatgctgccagaccacgtcgctcgacac
ttccttggctccaagaagcgggacgaggagctatacagccagtcttacgatgagattggc
gtcatgtttgcgtcactccccaactttgctgacttctacacggaggagagcatcaacaat
ggcgggatcgagtgcctgcgctttctcaacgagatcatctcggatttcgacgcgctcctg
gatgaccctcagttccgctgcatcaccaagatcaaaaccattggcagcacctacatggca
gcttctggagtgacccccgacgtcaacaccaatggctacaacaatgctgttaagaaggaa
gaactttcggaaaaggagcgctggcagcacttggcagatcttgctgacttcgccctggcc
atgaaggagacactgatgaacatcaactatcagtccttcaataacttcatgctgagaata
ggcatgaataagggggcagtgcttgcgggggtcattggtgcccgcaaacctcactatgat
atttgggggaacacagtgaacgtggccagccgaatggagtccacaggcgtcatggggaac
attcaggtggtggaggaaacccacttcattctgaaggagtacgggttccgctttgtgcgc
cgagggcacatcttcgtcaagggcaaaggggacctcttgacctacttcatgaaaggccgc
gagaaacaaggatccttcgtcaacggctcttgcgtgactttgcctcaccaggtggttgac
agctcatga

DBGET integrated database retrieval system