KEGG   Podarcis muralis (common wall lizard): 114596511
Entry
114596511         CDS       T06059                                 

Gene name
TPP2
Definition
(RefSeq) tripeptidyl-peptidase 2 isoform X1
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
pmua  Podarcis muralis (common wall lizard)
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pmua01002]
    114596511 (TPP2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pmua03110]
    114596511 (TPP2)
Enzymes [BR:pmua01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     114596511 (TPP2)
Peptidases and inhibitors [BR:pmua01002]
 Serine peptidases
  Family S8: subtilisin family
   114596511 (TPP2)
Chaperones and folding catalysts [BR:pmua03110]
 Intramolecular chaperones
  Subtilisin family
   114596511 (TPP2)
SSDB
Motif
Pfam: TPPII Peptidase_S8 TPPII_N
Other DBs
NCBI-GeneID: 114596511
NCBI-ProteinID: XP_028584023
LinkDB
Position
4
AA seq 1263 aa
MAAAAAGEEQYPFQGLLPKKETGAASFLSRYPEYDGRGVLLAVLDTGVDPGAPGMQITTD
GKPKIIDIIDTTGSGDVNTSTVVEPKDGEIIGLSGRTLKIPTDWVNPSGTYHIGLKNGYD
FYPKALKERIQKERKEKLWDPVHRLVLAEACRKQDEFEAAHSSPSQESKLMKEELQSQVE
LLNSFEKKYSDPGPVYDCLVWHDGETWRACIDSSETGDFSNCTVLRNYKEGQEFGSFGTS
EMLNYSVNIYDEGNLLSIVTSGGAHGTHVASIAAGYFPDEPDRNGVAPGAQILAIKIGDT
RLSTMETGTGLIRAMIEIIKYKCDLVNYSYGEATHWPNAGRICEIINEAVWKHNVIYVSS
AGNNGPCLSTVGCPGGTTSSVIGVGAYVSPDMMVAEYSLREKLPANQYTWSSRGPSTDGA
LGVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKANDVRYTVHSVR
RALENTAVKVENIQVFAQGHGVIQVDKAYDYLIQNSTFADNIGFTITVGNNRGIYLRDPA
QVAVPSDHGVGIEPFFPENTDNADRISLQLHLALTSNASWVQCPTHLELMNQCRHINIRV
DPRGLREGVHYTEVCGYEISMPNAGPLFRIPVTVVIPARTDEASHYDLKFTDVHFKPGQI
QRHFVEVPSGATWAEVTVCSSSPDVTAKFVLHAVQLVKQKAYRSHEFYKFSSIPEKGSVT
EAFPVLGGRTIEFCIARWWASLNDVSIDYTLSFHGIVCTASQLNVHASEGIVRFDVQTTL
RYEDIAPSINLKSWVQTLRPLSAKIKPLGSRDVLPNNRQLYEMVLTYNFHQPKSGEVTPS
CPLLCELLYESEYDSQLWIIFDQNKKQMGSGDAYPHQYSMKLEKGDYTVRLQIRHEQNSE
LDRLKDLPFIISHRLSSALNLDIYESHAQALLGKKKANSMSLPPKHSQPFFVSALPDDKV
PKGASPGCYLAGSLTLSKTDLGKKAGQSAAKRQGKFKKDIIPVHYHLIPSPIKSKNGNKE
KEKEPEKEKDAKDEFAEALRDLKIQWMTKLETSDMYNELKEAFPNHLPLYVARLHQLDSE
KERMKRLNDIIEAANTVISHIDQTALAIYLAMKTDPRPDAATIKNEMDKQKSTLVDALCR
KGSALSDQILQFQAQEGAVSGDAEPKDDQQEGGLDALAETFWEITKWTDLFDTKVLPFAY
KHALVNKMYGRGLKFATKLAEEKPTKENLKNCILLMKLLGWTHCASFTENWLPVMYPPDY
CVF
NT seq 3792 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggccggtgaggagcagtaccctttccaagggctccttcccaagaaa
gagaccggcgctgcctccttcctgtcccggtacccggagtatgacgggcggggagtgctg
ctggccgtcctagacacgggcgtggaccccggagcgccaggcatgcagattacaactgat
gggaaacctaagataattgacataatagatacaacaggcagtggtgatgtaaacacttca
actgttgtagaaccaaaagatggagaaatcattggtctttcaggaagaactctgaagatc
ccaacagactgggtaaatccttcaggaacatatcacattggcttaaaaaatggttatgac
ttctaccctaaagctctcaaggaaagaatacagaaagaacgcaaggaaaagctttgggat
cctgttcacagattggtgctcgcggaagcctgcaggaaacaagatgagttcgaagctgct
cacagctctccatcgcaggaaagcaaactgatgaaggaagagcttcagagtcaagtggag
ttgctgaattcttttgagaaaaaatacagtgatcctggccctgtatatgactgcttggtg
tggcatgatggtgaaacttggagagcttgtatagattcaagtgaaactggtgacttttct
aactgcacagttttacgcaactacaaggaaggtcaagaatttggatcgtttggcacgtcg
gagatgttgaattactctgtcaatatctatgatgaagggaacttgctctcgattgttacc
agtggaggagcacatgggacacatgttgctagcatagctgctgggtattttccagatgaa
ccagatcgtaatggggtggcccctggtgcacaaattcttgcaattaagattggtgatacg
agattaagcaccatggaaactggcactggccttatcagagctatgatagaaataataaaa
tataagtgtgaccttgtcaactacagctatggagaagcaactcactggccaaatgctggg
agaatatgtgaaattataaatgaagctgtatggaaacacaatgtaatctatgtttcaagt
gctgggaacaatggtccttgcctttcaacagttggttgcccaggtggaactacatctagt
gtgattggtgttggtgcttacgtatcacctgatatgatggttgctgagtattccttgcga
gagaaacttcctgcaaatcagtacacttggtcatctcgagggcctagtaccgatggagca
ctgggagtaagcatcagcgcacctggaggcgctattgcctctgtccctaactggacatta
cgagggacacagctcatgaatggcacatcaatgtcttcaccgaacgcatgtggtggcatt
gccttggtactatcaggacttaaagctaatgatgtgcgctacactgttcattcggtcagg
agagccctggaaaatactgcggtgaaggtggaaaacatacaggtgtttgcccaaggacat
ggtgttattcaggttgataaagcctatgactacctcatccagaactcaacatttgctgac
aacataggcttcaccattactgttggcaacaaccgtggaatctacctcagagatcctgcc
caggtagctgtgccttctgaccatggtgttggcatagagcccttcttccctgaaaacaca
gacaacgctgacaggatatctctccagcttcatttagctttaacttcaaacgcatcctgg
gttcagtgccctactcatctggagctcatgaaccaatgtagacatattaacattcgcgtg
gatccgcgtggcctgcgagaaggagttcactatacagaggtgtgtggttatgaaatatct
atgcctaacgcaggccccctctttagaattccagtgactgttgttataccagcaagaaca
gatgaagcttcacactatgatctcaagttcactgacgtgcattttaaacctggtcaaatc
caaagacactttgttgaagtcccttctggagcaacgtgggctgaagtaacagtatgttcc
tcatcacctgatgtaactgccaagtttgttcttcatgcggttcaactagtaaagcaaaag
gcgtaccgaagccatgagttctacaagttctcttcaataccagaaaagggatcagtcact
gaagcttttcctgtcctaggtggaagaacaattgaattttgcattgcccgttggtgggca
agcctcaatgatgtcagcattgattacaccctatccttccatggcatagtttgcactgct
tctcaattaaacgttcatgcttcggaaggcatcgtgcgctttgatgttcagacaacattg
agatatgaagacattgcaccttccataaatctgaaaagctgggttcagacactaaggcca
ctgagtgctaaaataaagccattaggatcacgggatgttttgccaaataatcggcaattg
tatgagatggttttgacgtacaactttcatcaacctaagagtggagaagtcactcccagt
tgtcctttgctctgtgagctcttgtacgagtcagaatatgacagccagttgtggatcatc
tttgaccagaataaaaaacagatggggtcaggagatgcttatcctcaccagtattccatg
aaattggagaaaggcgattacaccgttcggctacagatccgccacgagcagaacagcgaa
ctggatcgtctcaaagaccttccgtttattatctctcatagactgtctagtgccctgaat
ttagatatttacgaaagccacgcccaggctctcttggggaagaagaaagcaaacagtatg
tctctgccaccaaaacatagccagcccttctttgtttccgctttgccagatgacaaagta
cctaaaggagcaagtccaggctgttaccttgcaggatcattaactctttcaaagactgat
cttggaaagaaagcggggcagtctgcagcaaagcgacaaggaaagtttaaaaaggatata
attccagttcactatcatctgatcccatcaccaataaaaagtaagaatggcaacaaggag
aaggagaaagagcctgaaaaggaaaaagacgcaaaggatgaatttgctgaagctttaaga
gacctgaagatacaatggatgactaagctggagaccagtgacatgtataatgaattgaaa
gaggccttccctaatcatctgcccttgtatgttgcaagacttcatcagctggattctgaa
aaggaaagaatgaaaaggttgaacgacattattgaggcagctaatacggttatctcacat
attgatcaaacagccctcgccatttatctcgctatgaagacagatcccagacctgatgct
gctactataaaaaatgagatggacaagcagaaatctacgttagtggacgctctctgtcgg
aaaggaagtgcgttgtccgaccaaatcctgcagtttcaggcccaagaaggggctgtgtca
ggcgatgcagaacctaaagatgaccagcaggagggtggcttggatgctctggcagaaact
ttctgggaaataaccaaatggactgacctgttcgacaccaaggttttaccatttgcctat
aagcacgccctggtaaataaaatgtacggccgaggtctcaaatttgcaacaaagcttgcg
gaagagaaacctaccaaagaaaacttgaagaattgcatactgctaatgaagttacttgga
tggacacactgtgcatctttcactgaaaactggcttcccgtgatgtatccacccgattat
tgtgtgttttga

DBGET integrated database retrieval system